(data stored in ACNUC7421 zone)

EMBL: CP001022.PE62

CP001022.PE62        Location/Qualifiers
FT   CDS_pept        79433..80431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0063"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; dihydroorotate dehydrogenase;
FT                   KEGG: bcl:ABC0116 tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59550"
FT                   /db_xref="GOA:B1YGR7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGR7"
FT                   /protein_id="ACB59550.1"
FT                   /translation="MMTGFKIGDVELNNRVILAPMAGVCNPAFRLIAKEFGAGLVCAEM
FT                   VSDKGILYENERTMQMLYVDDREKPLSLQIYGGSKETLVQAAQYVDANTNADIIDINMG
FT                   CPVPKVTKCDAGAKWLLDPDKVYEMVHAVSQAVDKPVTVKMRTGWDSHHIYCVDNVRAA
FT                   EAGGAKAVAIHGRTRSQKYEGVADWNIIGEAKRAVTIPIIGNGDVQTPQDAKRMIDEIG
FT                   VDGVMIGRAALGNPWMLYQTIQYLESGTLSVEPTPREKIDICLLHAERLVALKGEDLAV
FT                   REMRTHVAWYLKGLSGNGHVRKALFDTNTHTGLQKLLHEYVETLEMNAVHA"
     atgatgacag gttttaaaat aggtgacgtc gaactgaata accgtgtcat tttagcaccg        60
     atggcgggtg tctgtaatcc tgcgtttcgt ttgatcgcaa aagaattcgg ggcaggtctc       120
     gtctgtgcag aaatggtcag tgataaggga atcctctacg aaaacgaacg gacaatgcaa       180
     atgctgtatg tggacgatcg ggaaaaaccg ctcagtttgc agatttacgg cggatcaaaa       240
     gaaacgttgg ttcaagcggc tcaatatgtc gatgcgaata cgaatgcaga catcatcgac       300
     atcaatatgg ggtgtcctgt tccaaaagtg acgaagtgtg acgcgggtgc caagtggttg       360
     cttgatccgg ataaagtcta tgagatggtt catgccgtat cacaagcggt ggataaaccc       420
     gttacggtga agatgcgaac cggctgggac agccaccata tttattgtgt tgataatgtc       480
     cgcgctgcgg aagcgggagg ggcgaaggcg gtcgctattc acggccggac ccggtcgcag       540
     aagtatgaag gcgtcgccga ttggaatatc atcggtgaag caaaacgggc cgtgactatt       600
     ccgatcatcg gaaacggtga tgttcaaacc ccgcaagacg cgaaacggat gattgatgaa       660
     atcggggtgg acggtgtcat gatcgggcga gcggcactcg gaaatccgtg gatgttgtat       720
     cagacgattc aatatttgga atcgggtacc ctgtcggtcg agccgacgcc acgtgagaaa       780
     attgatattt gcctgttaca tgccgaacgt cttgtcgcac ttaaaggaga agacctcgcg       840
     gtacgggaaa tgcggactca tgtcgcctgg tatttaaaag gattaagcgg caacgggcat       900
     gtgcgcaaag ccttattcga tacgaatacc cacacaggac tgcaaaagtt gctgcatgag       960
     tatgttgaaa cattggaaat gaatgccgta catgcgtga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page