(data stored in ACNUC7421 zone)

EMBL: CP001022.PE65

CP001022.PE65        Location/Qualifiers
FT   CDS_pept        93476..93904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_2350 UvrB/UvrC motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59553"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGS0"
FT                   /protein_id="ACB59553.1"
FT                   /translation="MRCQRCGEREAVVRVKLPQDQEGTEQILCSVCVKELAKAYQETAC
FT                   PSCGMTRQQLLHLRKVGCATCYSFFKEEVDGMIRQFQHGHTKHYGSRPEEESVEKRLVQ
FT                   QLSRLREQLNRKILSEDYEEAEIIKQQIVNVEEDLRHV"
     atgcgttgtc agcggtgtgg tgaacgggaa gctgtcgtcc gtgtcaaact tccacaagat        60
     caagaaggaa ccgaacaaat cctttgttcg gtttgtgtaa aagaattggc aaaagcctat       120
     caagaaaccg cttgtccttc atgtgggatg acacgtcaac aacttttaca tttacgaaaa       180
     gttggttgtg caacatgcta ttcgtttttt aaagaagaag tcgacgggat gattcgtcag       240
     tttcaacacg gtcatacgaa acattacggt tcacgtcctg aagaagagtc ggtcgaaaaa       300
     cgtttggtcc agcagttgag tcgactcagg gaacagttga atcggaaaat cttatcggaa       360
     gactatgaag aagcagaaat catcaaacaa caaattgtaa atgtggagga ggatttgcgc       420
     catgtttga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page