(data stored in ACNUC7421 zone)

EMBL: CP001022.PE67

CP001022.PE67        Location/Qualifiers
FT   CDS_pept        94970..97417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0068"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: UvrB/UvrC protein; AAA ATPase central domain
FT                   protein; Clp domain protein; ATPase associated with various
FT                   cellular activities AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: bha:BH0103 class III stress
FT                   response-related ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59555"
FT                   /db_xref="GOA:B1YGS2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGS2"
FT                   /protein_id="ACB59555.1"
FT                   /translation="MMFGRFTERAQRVLALAQEEAVRLGHHNIGTEHILLGLVREGDGI
FT                   AAKALTALGLSSDKIQMEVEALIGRGQDGATTIHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHLLLGLIREGEGVAARVLNNLGISLSKARQQVLQLLGNSETTANASQAGSGVATPTL
FT                   DGLARDLTQQARETRLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAVVEGLA
FT                   QQIINNEVPETLRNKRVMVLDMGTLVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDEL
FT                   HTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIQVA
FT                   EPTTDEATQILFGLRDRYEAHHRVTITDEAIQEAVTLSDRYISDRFLPDKAIDLIDEAA
FT                   SKVRLRSYTAPPNLKEVEAKLEGIRKDKDEAVQSQEFEKAASLRDTEQKLRDELERLKE
FT                   EWQNKQGNEKLEVTKDDIAQVVANWTGVPVTKIAEEETDRLLRLEEILHGRVIGQNEAV
FT                   KSISKAIRRARAGLKDPKRPIGSFIFLGPTGVGKTELARAVAEAMFGDEDAIIRIDMSE
FT                   YMEKHATSRLVGSPPGYVGYEEGGQLTEKVRRKPYSVILLDEIEKAHPEVFNILLQVLD
FT                   DGRLTDSKGRTVDFRNTIIVMTSNVGASALKRNKYVGFAVSDDTDREYKDMKGKVMEEL
FT                   KRAFRPEFLNRIDETIVFHSLEKKHIEEIVKLMAKTLEKRLAEQQVHFELTPAALSKIA
FT                   DIGYDPEYGARPIRRALQREAEDRLSEALLAGDIQKGERVALDVEDGEFIVRRHQAEPA
FT                   TTE"
     atgatgtttg gacgattcac agaacgtgct caacgcgtac tcgcacttgc tcaagaagaa        60
     gcggtacgtc ttggtcacca taatatcgga acagaacaca ttttactcgg acttgtacgt       120
     gaaggagacg ggattgcggc gaaagcctta acagcactcg gactcagttc agataagatt       180
     caaatggaag ttgaagcttt aatcggtcgc ggtcaagacg gtgcgacaac gattcactat       240
     acaccacgtg ccaaaaaagt catcgagctt tcgatggatg aggcccgtaa actcggtcat       300
     tcgtatgtcg gaacagaaca ccttctactt ggtttgatcc gtgaaggaga aggcgtggca       360
     gcacgtgtat taaacaacct tggcatcagc ctctcgaaag cacgtcagca agtacttcaa       420
     ttgcttggca acagcgaaac gacagcgaat gcgtcacaag caggatctgg cgtcgcaaca       480
     ccgacacttg atggtctggc acgcgactta acgcaacaag cacgggaaac acgtcttgat       540
     ccggtcatcg gtcgttcaaa agaaattcaa cgtgtcattg aagtcttaag ccgccggacg       600
     aaaaacaacc cggtcttgat cggagaaccc ggtgtcggta aaacagccgt cgttgaaggt       660
     cttgcccaac aaatcatcaa taatgaagtg ccggagacat tacggaataa acgtgtcatg       720
     gttctcgata tggggacact cgtcgctgga acaaaatacc gtggtgagtt cgaagaccgt       780
     ttgaaaaaag tcatggatga gattcgtcag gctggaaaca tcattctctt catcgatgaa       840
     ttgcacacat tgattggtgc cggtggagca gaaggtgcaa tcgatgcttc gaatatcttg       900
     aagccgtcac ttgcccgcgg agaactccag tgtatcggag cgacaacact cgatgagtac       960
     cggaaataca tcgaaaaaga tgcggcactc gaacgtcgtt tccaaccgat tcaagtagct      1020
     gaaccgacaa cggatgaagc gacacaaatc ttgttcggtc tgcgtgaccg ttatgaagcg      1080
     caccaccgtg tgacaatcac ggatgaagcg atccaagaag ccgttacact ctcggaccgt      1140
     tacatttcag atcgtttcct accggataaa gcaatcgact tgattgacga agcggcttca      1200
     aaagtccgtt tacgttctta tacagcacca ccgaacttaa aagaagtcga agcgaagctt      1260
     gaaggtattc gcaaagataa agatgaagcc gttcaaagcc aggaattcga aaaagcagcc      1320
     agtctccgtg atacagaaca aaaattacga gatgaattgg aacgcttaaa agaagaatgg      1380
     cagaacaagc aaggcaacga gaaactggaa gtgacaaaag acgatatcgc ccaagtcgtc      1440
     gccaactgga caggtgttcc ggtcacgaag atcgcggaag aagagacaga tcgtctgctt      1500
     cgcctcgaag aaattcttca tggacgtgtc atcggtcaaa acgaagccgt taaatcgatt      1560
     tcaaaagcca tccgtcgtgc acgtgccggc ttaaaagatc cgaaacgtcc gattggttca      1620
     ttcatcttcc ttggaccaac cggtgtcggt aaaacggaac ttgcccgggc tgtcgcagaa      1680
     gcgatgttcg gtgacgaaga tgcgatcatc cggatcgata tgtccgagta catggagaaa      1740
     catgcgacaa gtcgccttgt cggttctcct ccgggatacg tcggatatga agaaggcggt      1800
     cagttaactg agaaagtacg ccggaaacca tattccgtca tcctgcttga tgaaatcgag      1860
     aaagcacacc ctgaagtctt caacatctta cttcaagtgc ttgacgacgg tcgcttaacg      1920
     gattcaaaag gtcggactgt cgacttccgt aatacaatca tcgtcatgac gtcaaacgtc      1980
     ggagcaagtg ctcttaaacg caataaatat gttggttttg cggtctccga tgatacggat      2040
     cgtgagtaca aagacatgaa gggtaaagtt atggaagagt tgaaacgcgc cttccgtcct      2100
     gaattcttga accggattga cgaaacaatc gtcttccact cacttgagaa gaaacacatc      2160
     gaagaaatcg taaaactcat ggcgaaaacg cttgagaaac gccttgcaga acaacaggtt      2220
     catttcgagt tgacgccggc tgcgctctcg aaaatcgcgg atatcggata tgatccggaa      2280
     tacggagccc gtccaatccg tcgggccctt caacgggaag cagaagaccg cttgtcagaa      2340
     gcattgctcg caggcgatat tcaaaaaggt gagcgggtgg cacttgatgt cgaagatggt      2400
     gaattcatcg tccgccgtca tcaagctgaa ccagcaacga ccgaataa                   2448
//

If you have problems or comments...

PBIL Back to PBIL home page