(data stored in ACNUC7421 zone)

EMBL: CP001022.PE68

CP001022.PE68        Location/Qualifiers
FT   CDS_pept        97488..98873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0069"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: bsu:BSU00870 DNA repair protein RadA; TIGRFAM:
FT                   DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59556"
FT                   /db_xref="GOA:B1YGS3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGS3"
FT                   /protein_id="ACB59556.1"
FT                   /translation="MNRLAKIKTKFVCQSCGTESPKWMGRCSGCGEWNTMVEEVVEEKK
FT                   ARRGSAFVHTTTKQLKPERLSNILSQEESRVFTGSGEFDRVLGGGIVPGSMVLVGGDPG
FT                   IGKSTILLQTSARLAARGEKVLYISGEESLKQTKLRAERLGLPTQDLFVLSETDMNMIE
FT                   RVVDEENPAFLIIDSIQTVYIDEIQSAPGSVTQVRECTAMLMKIAKSRGIAIFIVGHVT
FT                   KQGSIAGPRLLEHMVDAVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMRESGLEEVL
FT                   NPSEIFLEERTSGVSGSTIVASMEGTRTVLVELQALISPTSFGNPRRMATGIDQNKVAL
FT                   LMAVLEKRSGLLLQTQDAYLKAAGGVKLDEPAIDLAICVAVASSFRDKPTRPTDVVIGE
FT                   VGLTGEVRRVSRIEQRVAEAAKLGFTRAIIPKNNLGGWTYPPGITVIGVESVDEALRET
FT                   IPF"
     atgaatcgct tggctaaaat aaagacgaaa tttgtctgcc agagttgtgg aacggaatct        60
     ccgaaatgga tgggccgttg ctccggctgt ggcgaatgga acacgatggt tgaagaagtc       120
     gttgaagaga aaaaagcacg gcggggttcc gcttttgtgc atacgacgac taaacaatta       180
     aaaccggaac gtttatcgaa tatcctgtcc caggaggaaa gtcgtgtctt caccggcagc       240
     ggtgaatttg accgggtcct cggtggtgga atcgtccccg gttcaatggt ccttgtcgga       300
     ggagacccgg gaatcgggaa gtcgacgatt ttacttcaga cgagcgcacg tctcgccgca       360
     cgcggggaga aggttctgta tatatcgggt gaggaatcgc ttaagcaaac gaaattacgg       420
     gcggaacgac tcgggttacc gacgcaggat ctgtttgtct taagtgagac ggatatgaat       480
     atgattgagc gtgtcgtcga tgaagaaaac ccggcctttt tgatcatcga ttcgattcaa       540
     accgtctata ttgatgaaat ccaatcagct ccgggtagtg tgacgcaagt ccgggaatgt       600
     acggcgatgc tgatgaaaat cgccaaaagt cgtggaatcg ccatcttcat cgtcggtcac       660
     gtgacgaaac aaggatcgat tgccggacct cgtctgcttg agcatatggt ggatgccgtt       720
     ttgtacttcg aaggagagcg ccatcacacg ttccggattt tgcgggctgt taaaaaccga       780
     ttcggttcga cgaatgaaat cgggattttt gaaatgcgcg aatcgggtct tgaagaagtc       840
     ttgaatccgt cggagatttt cctcgaagaa cggacgtccg gtgtatccgg ttcaacaatt       900
     gtcgcttcga tggaagggac gcggacggta ttggtggaac tgcaagcctt gatttcgccg       960
     acctcgttcg ggaacccgcg tcgcatggca acggggatcg atcaaaataa agtcgcgtta      1020
     ctgatggctg ttttggaaaa acgatcgggc ttgttgctgc agacacaaga tgcctatctc      1080
     aaggcagcgg gtggcgtcaa actcgatgaa ccagcaatcg atttagcgat ttgtgtggcg      1140
     gtcgcttcga gtttccgcga taagccgaca cgaccgacgg atgttgttat cggtgaagtc      1200
     ggattgaccg gtgaagtccg acgcgtctca cggattgaac agcgtgtcgc ggaagcggcg      1260
     aagcttggct tcacacgtgc gatcattccg aagaacaacc tcggtggatg gacgtatccg      1320
     cccggcatca cggtcatcgg cgtcgaaagt gtcgatgaag cattgcggga aacaattccg      1380
     ttttaa                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page