(data stored in ACNUC7421 zone)

EMBL: CP001022.PE77

CP001022.PE77        Location/Qualifiers
FT   CDS_pept        106360..106890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0078"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   bcy:Bcer98_0087 protein of unknown function DUF901"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59565"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGT2"
FT                   /protein_id="ACB59565.1"
FT                   /translation="MKYDRLIVDGYNIIGAWPEFRTLREQDFELARERLVDAMAEYQAV
FT                   TGISVTIVFDAYLQPGRESRIKKSGIEVIYTRENETADEWIEKTAAEWLQDIRVKLTVA
FT                   TNDFTEQWVIFTLGALRVSAQELRRDWKAAVAVIRGQTITSKTSQKPRSTIDMPADVIE
FT                   RLEEIRRRKNSDS"
     atgaaatacg accgtctgat cgttgatggc tacaatatca ttggcgcatg gccggagttc        60
     cggacattgc gggagcagga ttttgaatta gcacgggaac gattggtcga tgcgatggcc       120
     gagtaccaag ccgtgacggg aatcagtgtg acgatcgtct ttgatgccta tctgcaaccg       180
     ggacgggaat cccgaattaa gaaaagcggt atcgaagtca tttacacacg ggaaaacgaa       240
     acggcggatg aatggattga aaaaacagca gcggaatggt tacaggatat ccgggttaaa       300
     ctgacggtcg caacaaacga tttcaccgaa caatgggtca tcttcacact cggtgcctta       360
     cgggtttcag cacaggaact gcgccgggac tggaaggcgg cggtcgccgt gatccgcgga       420
     cagaccatta cgtcaaaaac gagtcaaaaa ccacgttcga caatcgatat gccggctgat       480
     gtcattgaac ggctcgaaga aatccggcgg cgcaaaaatt cagattcatg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page