(data stored in ACNUC7421 zone)

EMBL: CP001022.PE78

CP001022.PE78        Location/Qualifiers
FT   CDS_pept        107080..107721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0079"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-H factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bwe:BcerKBAB4_0088 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59566"
FT                   /db_xref="GOA:B1YGT3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGT3"
FT                   /protein_id="ACB59566.1"
FT                   /translation="MSLVSFDQFECMTDEALVEQAKVFDNSDALEFLIERYRNFVRAKA
FT                   RSYFLIGADREDIIQEGMIGLYKAVRDYRTDKLASFKGFAELCITRQMITAIKTATRQK
FT                   HIPLNSYISLDKPIYDDESERTLLDIITSTAPSDPQVLIVNREEYADIESKMDEILSDL
FT                   ERKVLALYLDGRTYQEISDDLDRHVKSIDNALQRVKKKLERYLEARKLTV"
     atgagtttgg tttcgttcga ccagtttgag tgcatgaccg atgaggcgct tgtggaacag        60
     gcgaaggtat ttgacaacag tgatgcgctc gaatttctga tcgagcggta tcggaacttt       120
     gtgcgtgcaa aagcacggtc ttactttttg atcggagcgg accgcgaaga tatcatccaa       180
     gaaggcatga ttggtctgta taaggcagtc cgggattatc ggacggataa gctggcttcc       240
     tttaaagggt ttgctgaact gtgtattacc cggcagatga ttacggcgat taaaaccgca       300
     acacgtcaaa aacatatccc gcttaattca tacatttcgc ttgataaacc gatttacgat       360
     gatgagtcgg aacggacgtt gctcgatatc attacatcga ccgccccgtc ggatccgcaa       420
     gtgttgatcg tcaaccggga agagtatgcg gatatcgaaa gcaagatgga tgagattctc       480
     agtgatctgg aacgcaaggt gcttgcgctt tatctcgacg gaagaaccta tcaagaaatt       540
     tccgacgatc tcgatcgtca tgtcaagtcc atcgataatg cccttcaacg cgtaaagaaa       600
     aagctggaac ggtatctcga agcgcgaaaa ctgacggtct ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page