(data stored in ACNUC7421 zone)

EMBL: CP001022.PE8

CP001022.PE8         Location/Qualifiers
FT   CDS_pept        15734..17200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0008"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="KEGG: gtn:GTNG_0009 inosine-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: CBS domain containing protein; IMP
FT                   dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59496"
FT                   /db_xref="GOA:B1YGB9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGB9"
FT                   /protein_id="ACB59496.1"
FT                   /translation="MWENKFAKEGLTFDDVLLVPRRSSVLPRDVDLSVTLCEGITLNIP
FT                   LISAGMDTVTEAPMAIAMARQGGLGVIHKNMSMEDQAEHVDRVKRSENGVITNPFYLTP
FT                   ERQVYDAEYLMSKYRISGVPIVNNETERKLVGILTNRDLRFVKDYSTVIETVMTTEELV
FT                   TAKVGTSLEEAEQILHKHRIEKLPLVDENGVLKGLITTKDIEKVEQYPHAAKDSFGRLL
FT                   VAAAVGVTKDASVRAKFLVDAGVDALVVDTAHGHSEGVLVKVRELRDEYPNLPIIAGNV
FT                   ATAEATRDLIEAGASVIKVGIGPGSICTTRVVAGVGVPQITAVFDCATEARKHGVSIIA
FT                   DGGIKYSGDIVKALAAGGHAVMLGSLLAGVEESPGEMEIYQGRQFKTYRGMGSEASMKR
FT                   GSQDRYFQEADKKFVPEGIEGRVAYRGKLGDSVYQLVGGIRSGMGYCGSASLEELREET
FT                   QFIRMTGAGLQESHPHDIQITKEASNYTRQ"
     atgtgggaga acaaatttgc taaagaaggc ttgacgtttg atgacgtctt gctcgtacca        60
     cgtcgttcaa gtgtcttacc gcgagatgtt gatttgtctg taacattatg cgaaggaatt       120
     acattaaaca ttcctttaat cagtgcaggg atggataccg taacagaagc tccgatggcg       180
     attgccatgg cacgtcaagg tggtcttgga gtcatccaca agaacatgtc gatggaagat       240
     caagccgaac atgtcgatcg tgttaagcgg tcggagaatg gtgtcattac aaatccgttt       300
     tacctcacgc cagaacgaca agtctatgat gctgaatatt tgatgagcaa gtaccggatt       360
     tcaggtgttc cgattgtcaa taacgaaaca gaacgcaaat tggtcggtat cttaaccaac       420
     cgcgatctcc gtttcgtgaa agattactct acggtcattg aaactgtcat gacgacggaa       480
     gaactggtca cagcaaaagt cggtacttct ttagaagaag ccgaacaaat tctccacaaa       540
     catcggattg aaaagttacc actcgtcgat gagaacggag ttttaaaagg tttgattaca       600
     acaaaggata ttgaaaaagt tgaacagtat ccgcacgcag ctaaagattc atttggacgt       660
     ctgctcgtcg cagcagctgt cggtgtaacg aaagatgcct cggttcgtgc taagttcctc       720
     gtagatgcag gagttgacgc attggtcgtc gacacggcac acggtcactc agaaggggtt       780
     ctcgtgaaag tacgcgaact tcgggacgag tatccgaact tgccgatcat cgcaggaaac       840
     gtcgcaacag ctgaagcgac acgtgacttg attgaagcag gtgcttctgt catcaaagtc       900
     ggaattggac cagggtctat ctgcacgaca cgtgtcgtgg ccggagtcgg tgttccacaa       960
     atcacagcag tctttgattg tgcaacagaa gcccgtaagc acggtgtctc gattatcgct      1020
     gatggcggga tcaagtattc cggtgatatc gtcaaagcac ttgcagcagg cggtcatgcg      1080
     gttatgttag gcagccttct cgccggcgtg gaagaaagcc cgggagaaat ggagatttac      1140
     caaggccgtc aattcaagac atatcgtggt atgggatcgg aagcctcaat gaaacgcggc      1200
     agccaagacc gttacttcca agaagctgac aagaaatttg ttccagaagg aatcgaaggt      1260
     cgcgtcgcat atcgcggtaa actcggtgac tcggtttacc aactcgtcgg agggatccgc      1320
     tcaggaatgg gatactgtgg ttctgcttca cttgaagaat tacgtgaaga aacacagttc      1380
     atccggatga caggtgcagg gttacaggaa agccatcctc acgatattca gattacgaaa      1440
     gaagcttcaa actatacacg tcaataa                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page