(data stored in ACNUC7421 zone)

EMBL: CP001022.PE81

CP001022.PE81        Location/Qualifiers
FT   CDS_pept        108260..108811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0082"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: NGN domain protein; KEGG: lwe:lwe0209
FT                   transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59569"
FT                   /db_xref="GOA:B1YGT6"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGT6"
FT                   /protein_id="ACB59569.1"
FT                   /translation="MDKQWFVVQTYSGFENNVKANLERRIESMNMDEKIFRVLVPIETV
FT                   QEEVTNKKGETKIKEREIKIFPGYVLVEMVMTDDSWYVVRNTPNVTGFLGSVGGGSKPT
FT                   PLLPEEAENILGSMGLVDMKSRYDFTMGQIVRIKEGVFANLEGTIEELETEAEKMKVSV
FT                   DMFGRETKVELDFSQVEKID"
     atggataagc aatggtttgt tgtccagacg tactctggat tcgaaaataa cgtcaaggca        60
     aatcttgaac gtcggattga atctatgaac atggacgaga aaatcttccg tgtactcgtt       120
     ccaatcgaaa cggtacagga agaagtaaca aacaaaaaag gtgaaacgaa aatcaaggaa       180
     cgtgaaatca agatcttccc ggggtatgtc ctcgtcgaga tggtcatgac ggatgattct       240
     tggtatgtcg tccgtaacac accgaacgtc acgggattcc tcggttcggt cggcggcggt       300
     tcgaaaccga caccacttct tcctgaagaa gcagaaaaca ttctcggatc aatgggactt       360
     gtcgacatga agagtcgtta tgactttaca atgggacaaa tcgtacggat caaagaaggc       420
     gtctttgcaa acctggaagg tacgatcgaa gagcttgaaa cagaagctga aaaaatgaaa       480
     gtttctgtcg atatgttcgg tcgtgaaacg aaagtagagc tcgatttctc acaagttgag       540
     aagattgact aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page