(data stored in ACNUC7421 zone)

EMBL: CP001022.PE84

CP001022.PE84        Location/Qualifiers
FT   CDS_pept        110449..110955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0085"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: btl:BALH_0097 50S
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59572"
FT                   /db_xref="GOA:B1YGT9"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGT9"
FT                   /protein_id="ACB59572.1"
FT                   /translation="MANEKVIAVKADLVSEIAEKMQASAGTIVVDYRGLTVDEVTELRK
FT                   QLREAGVEFKVYKNGLLRRAAVQSNLEGLDEVFTGPTAIAFSNEDVIAPAKILNNFSKD
FT                   HKALELKGGIIEGKVTSVEDVKALAELPSREGLLSMLLSVLQAPIRGLAVATNAIAEQK
FT                   EEQSA"
     atggcaaacg aaaaagttat cgctgtcaaa gcggatctcg tatctgagat cgctgagaaa        60
     atgcaagcga gcgctggaac aatcgtcgtc gactaccgtg gtctcacagt agacgaagta       120
     acagaacttc gtaaacaact ccgcgaagcg ggtgttgaat tcaaagttta caaaaacggt       180
     ctcctccgcc gtgctgcagt tcaaagcaat cttgaaggtc ttgacgaagt atttacaggt       240
     cctactgcga tcgccttcag caatgaagac gttatcgctc cagctaagat cttaaacaac       300
     ttctcgaaag accacaaagc tcttgagctt aaaggtggta tcatcgaagg caaagtcact       360
     tcagtagaag atgtcaaagc ccttgcggaa cttccatcac gcgaaggtct cctttcgatg       420
     cttctcagcg tgcttcaagc gccaatccgt ggtcttgcgg tggcaacgaa cgcaattgca       480
     gagcaaaaag aagaacaatc tgcttaa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page