(data stored in ACNUC7421 zone)

EMBL: CP001022.PE85

CP001022.PE85        Location/Qualifiers
FT   CDS_pept        111032..111397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0086"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: bha:BH0122 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59573"
FT                   /db_xref="GOA:B1YGU0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGU0"
FT                   /protein_id="ACB59573.1"
FT                   /translation="MAFNKEQFIEDLKGMTVLELNELVKTIEEEFGVSAAAPVAAAGAG
FT                   AAAAEEQTEFDVILTSAGSGKINVIKAVRELTGLGLKEAKALVDGTPAPVKEGVSKEDA
FT                   DAIKAKLEEAGASVEVK"
     atggctttca acaaagagca atttatcgaa gacctcaagg gcatgactgt tcttgaactt        60
     aacgaactcg taaaaacaat cgaagaagaa ttcggcgtat cagcagcagc tccagtagca       120
     gcagcaggtg caggcgcagc agcagctgaa gagcaaactg aattcgacgt aatccttact       180
     agcgcaggtt ctggtaaaat caacgtcatc aaagcagttc gcgaattgac aggcctcggt       240
     cttaaagaag cgaaagcact cgttgacgga actccagctc cagttaaaga aggcgtttcg       300
     aaagaagacg ctgacgcaat caaagctaag cttgaagaag ctggcgcaag cgtagaagtt       360
     aagtaa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page