(data stored in ACNUC7421 zone)

EMBL: CP001022.PE89

CP001022.PE89        Location/Qualifiers
FT   CDS_pept        119566..119817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0090"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   gtn:GTNG_0100 LSU ribosomal protein L7AE"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59577"
FT                   /db_xref="GOA:B1YGU4"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGU4"
FT                   /protein_id="ACB59577.1"
FT                   /translation="MSYKKVVGADLKFVGQKQTLKALRSGKASEVIIADDADEHVKQAL
FT                   LDAAKQANVPVVNVPSKLELGKACGIDVAATAVAIKKV"
     atgtcttaca aaaaagtagt cggcgcagat ttgaagtttg tcggtcaaaa gcaaacgctc        60
     aaagcattgc gatctggcaa ggcgtcggaa gtgatcatcg cagatgacgc agatgaacac       120
     gtaaagcaag cattgctcga tgcggcgaaa caagcaaacg ttccagtcgt gaacgttcct       180
     tctaagcttg agcttggtaa ggcttgtgga atcgacgttg cagcaactgc tgttgctatt       240
     aagaaagttt ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page