(data stored in ACNUC7421 zone)

EMBL: CP001022.PE90

CP001022.PE90        Location/Qualifiers
FT   CDS_pept        119943..120365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0091"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: gtn:GTNG_0101 ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59578"
FT                   /db_xref="GOA:B1YGU5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGU5"
FT                   /protein_id="ACB59578.1"
FT                   /translation="MPTINQLVRKGRQSKVVKSDSPALNKGYNSFIKARTDISSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNTMEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVDGRMQGRSKYGTKRPKAAKK"
     atgcctacta tcaaccaatt agtccgtaaa ggacgtcaat caaaagttgt gaaatcagat        60
     tcgccagcgc tgaacaaagg gtacaacagc tttatcaaag ctcgtactga catcagctca       120
     ccacaaaaac gtggtgtttg tactcgtgta ggtacaatga ctccgaagaa accgaactcg       180
     gctcttcgta agtacgcacg tgtgcgttta acgaacacaa tggaagtaac agcttacatc       240
     ccaggtatcg gccacaactt gcaagaacac agtgttgttc ttattcgcgg cggtcgcgta       300
     aaagacttac caggggtacg ttaccacatc gttcgtggtg cactcgatac agctggagtt       360
     gacggccgta tgcaaggtcg ttcgaaatat ggtactaaac gtccaaaagc agcaaaaaaa       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page