(data stored in ACNUC7421 zone)

EMBL: CP001022.PE91

CP001022.PE91        Location/Qualifiers
FT   CDS_pept        120415..120885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0092"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7; KEGG: bha:BH0130 30S
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59579"
FT                   /db_xref="GOA:B1YGU6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGU6"
FT                   /protein_id="ACB59579.1"
FT                   /translation="MPRKGQVERRDVMADPIYNSKLVTRLINRLMLDGKKGTAQQILYK
FT                   AFEAIAERSGRDAMEVFEEAMNNIMPVLEVKARRVGGANYQVPVEVRPERRTTLALRYL
FT                   VNYSRLRNEKTMDARLANEIMDAANNTGASVKKREDMHKMAEANKAFAHYRW"
     atgccacgta aaggtcaagt agaacgccgt gatgtaatgg ctgatccgat ctacaactct        60
     aaactcgtta cccgccttat caaccgtctt atgttagatg gtaaaaaagg tactgctcaa       120
     caaatcttat acaaagcttt tgaagctatc gctgaacgtt caggtcgcga tgcaatggaa       180
     gtttttgaag aggcgatgaa caacatcatg ccagttcttg aagttaaagc acgccgcgta       240
     ggtggagcta actatcaagt tcctgtcgaa gtccgccctg agcgccgtac gacacttgca       300
     cttcgttacc tcgtgaacta ctcacgtctc cgtaacgaaa aaacaatgga tgctcgtctt       360
     gctaacgaaa tcatggacgc tgcaaacaac actggtgctt cagttaagaa gcgcgaagat       420
     atgcacaaaa tggcggaagc gaacaaagcg tttgctcact accgctggta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page