(data stored in ACNUC7421 zone)

EMBL: CP001022.PE93

CP001022.PE93        Location/Qualifiers
FT   CDS_pept        123206..124393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0094"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: bha:BH0132
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59581"
FT                   /db_xref="GOA:B1YGU8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGU8"
FT                   /protein_id="ACB59581.1"
FT                   /translation="MGKEKFDRSKPHVNVGTIGHVDHGKTTLTAAISAVLAKSQGKAAT
FT                   KFDQIDGAPEERERGITIATAHIEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSATDGPMPQTREHILLSRQVGVPFIVVFMNKVDMVDDEELLELVEMEIRELLSEYDF
FT                   PGDDLPVIQGSALGALNGEAKWEEKIMELMNAVDEYIPEPTRDTEKDFMMPVEDVFSIT
FT                   GRGTVATGRVERGVLKVNDEVEIVGLHEETKKSVCTGVEMFRKLLDYAEAGDNIGALLR
FT                   GVSRDDIERGQVLAKPNTITPHKTFKAQVYILSKEEGGRHTPFFGNYRPQFYFRTTDVT
FT                   GMCQLPEGTEMVMPGDNIELTVELIAPIALEKETRFSIREGGRTVGAGSVTEIVE"
     atgggtaaag aaaaattcga ccgttctaaa ccgcacgtta acgttggtac aattggccac        60
     gtcgaccacg gtaaaacaac tttgacagca gctatctcag ctgtacttgc aaaatcacaa       120
     ggtaaagctg caactaagtt tgaccaaatc gatggtgctc cagaagagcg cgagcgcggt       180
     atcactatcg caacagctca catcgagtac gaaacagaca aacgccacta tgcacacgtt       240
     gactgcccag gtcacgctga ctatgttaaa aacatgatca ctggtgctgc acaaatggac       300
     ggcgcgatcc tcgttgtttc tgcaactgat ggtccaatgc cacaaacacg tgagcacatc       360
     ttgctttcac gtcaagtagg tgttcctttc atcgtagtat tcatgaacaa agtcgacatg       420
     gttgacgacg aagagcttct tgaactcgtt gaaatggaaa tccgcgaact tctttctgag       480
     tacgacttcc caggcgatga cctcccggtt atccaaggat ctgctctcgg cgcgcttaac       540
     ggcgaagcta aatgggaaga aaaaatcatg gaactcatga acgctgttga tgagtacatc       600
     cctgagccaa ctcgtgacac tgaaaaagac ttcatgatgc cagttgagga tgttttctca       660
     atcactggtc gtggtacagt agctactggc cgcgttgagc gtggagttct taaagtcaac       720
     gacgaagttg aaatcgttgg tcttcacgaa gaaactaaaa aatcagtatg tactggtgta       780
     gagatgttcc gtaagcttct tgactatgct gaagctggcg acaacatcgg agcacttctc       840
     cgtggtgtat cacgtgacga catcgagcgt ggacaagttc tcgcgaaacc aaacacaatc       900
     acaccgcaca aaactttcaa agcgcaagtt tacatccttt caaaagaaga gggtggccgt       960
     cacacgccat tcttcggtaa ctaccgtcca cagttctact tccgtacaac tgacgtaact      1020
     ggtatgtgcc aacttcctga aggaactgaa atggtaatgc ctggggacaa catcgaattg      1080
     actgttgaac tcatcgcgcc aatcgctctt gaaaaagaaa ctcgtttctc aatccgtgaa      1140
     ggtggccgta cagtaggcgc tggatcagtt acagaaatcg ttgagtaa                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page