(data stored in ACNUC7421 zone)

EMBL: CP001024.PE1

CP001024.PE1         Location/Qualifiers
FT   CDS_pept        49..942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_3056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lhe:lhv_0265 putative replicative protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_3056"
FT                   /db_xref="EnsemblGenomes-Tr:ACB62501"
FT                   /db_xref="UniProtKB/TrEMBL:B1YMS4"
FT                   /protein_id="ACB62501.1"
FT                   /translation="MEHEKSSNISPSSTVRVTKMNHLVEVQHMERMNRTNHIQKLDKER
FT                   YLNLKTGEIGEFKQGEVRSDSLNSLRQTFKKLRYLINTNYVGAGNELFITLTYKENMTD
FT                   VKRLYSDFKKFMLKFRYKYEKQYGSIDYMTVVEPQERGAWHHHLLVRFNDMTGSKMYIP
FT                   NNDVAALWGHGFTNMHSLNGVDNIGAYLSAYLADVELTTDNVFLAFDDNVEVVSKVVDG
FT                   QEKKFIKGGRLHLYPSGMNLYRKSKGIKMPVREEMRYGDIKKVVGSEKPHYVKTLVVEQ
FT                   DDFKNTITYEQYNTKR"
     atggaacacg aaaaaagctc taatatttct ccttcctcta cggtgcgagt aaccaaaatg        60
     aaccaccttg tggaagtgca acatatggag cgaatgaatc gtactaacca tattcaaaag       120
     ttagacaagg aacggtatct taatctcaag actggtgaga ttggtgagtt taaacaaggc       180
     gaggttagaa gtgacagtct taactcttta agacagacgt ttaagaagct ccgttatttg       240
     attaatacta actatgtggg tgctggtaat gagcttttca ttacccttac atacaaagag       300
     aatatgaccg acgttaagcg tttatatagt gattttaaga agttcatgct taagttccgt       360
     tataagtacg aaaaacagta tggatcaatt gactacatga ctgttgttga acctcaagag       420
     cgtggggcat ggcatcacca tttactcgtt agattcaacg atatgaccgg tagcaagatg       480
     tatattccta ataatgatgt tgcagcactg tgggggcatg gtttcacgaa tatgcattct       540
     ttaaacggtg tcgataatat tggtgcgtat ctgtcggctt accttgctga tgtggaattg       600
     actactgata atgtgttttt agcttttgat gacaatgtag aggttgtttc gaaggttgtt       660
     gatggtcaag agaagaagtt tatcaagggt ggtcgcttgc atctatatcc gagtggcatg       720
     aatctttacc gtaagtctaa agggattaaa atgcctgttc gtgaagaaat gagatatggg       780
     gacataaaaa aagtagtagg gtctgagaaa ccccactacg tcaagacttt agtcgtcgag       840
     caggacgact tcaaaaacac tatcacctac gaacagtata acacaaagcg ttaa             894
//

If you have problems or comments...

PBIL Back to PBIL home page