(data stored in ACNUC7421 zone)

EMBL: CP001024.PE2

CP001024.PE2         Location/Qualifiers
FT   CDS_pept        1388..1615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_3057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_3057"
FT                   /db_xref="EnsemblGenomes-Tr:ACB62502"
FT                   /db_xref="GOA:B1YMS5"
FT                   /db_xref="InterPro:IPR005569"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B1YMS5"
FT                   /protein_id="ACB62502.1"
FT                   /translation="MANENEMKRFNIRMPQDMFDRIEKTAHAKGVPVSAFINLKMDEIL
FT                   KQDEMAQSMNLLTDPVAFAKILEQYNGGKK"
     atggctaacg aaaatgagat gaaacgtttt aatatcagaa tgccacaaga tatgtttgac        60
     cgtatcgaga aaacggctca tgcaaagggt gttccagttt cggcatttat caacttgaaa       120
     atggatgaaa ttctgaaaca agacgaaatg gcgcaaagta tgaatttgct gactgatcca       180
     gttgcctttg caaaaattct agaacagtat aacgggggaa aaaaatga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page