(data stored in ACNUC7421 zone)

EMBL: CP001024.PE3

CP001024.PE3         Location/Qualifiers
FT   CDS_pept        1612..1758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_3058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_3058"
FT                   /db_xref="EnsemblGenomes-Tr:ACB62503"
FT                   /db_xref="UniProtKB/TrEMBL:B1YMS6"
FT                   /protein_id="ACB62503.1"
FT                   /translation="MSTPVERLKETLDEFSDEHMMITVSRKDLEALIRSYENLKKELEK
FT                   RSE"
     atgagtacac cagttgaacg gctcaaagaa actctagacg agtttagtga tgaacatatg        60
     atgattactg taagccgaaa agatttagaa gctctaattc gttcgtatga gaatctgaaa       120
     aaagagttgg aaaagcgttc agaatga                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page