(data stored in ACNUC29543 zone)

EMBL: CP001044.PE10

CP001044.PE10        Location/Qualifiers
FT   CDS_pept        complement(7319..8647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3111"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: nha:Nham_0997 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3111"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72279"
FT                   /db_xref="GOA:B2JR53"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR53"
FT                   /protein_id="ACC72279.1"
FT                   /translation="MSMPKIRSLRNQLVLALCVLVSVVGVVQGISSWQLAKAGMSALLD
FT                   LRLEQAASRLYKSGLAESLPAIPSRGSQPERDIYVTVWRDDIATPYRSTDPALALPRDA
FT                   DPGFTTAMVGGESWRIYTLREPSMVIQVAQRSRVRHELAQARSLDTLWPMIVLVPLVWI
FT                   AVLLVVRRALRRLTRLGAQVKAIDMTHFEQLSTSGVPTEIRPFITSINTMIGRLEQSIE
FT                   SERKFISDAAHELRTPLTALQLQADNLQPHIAPGNQERFRELQSGIRRSGRLIAQLLRL
FT                   ARADAALKADTLTRVDVSAVVVDAVAEVLPIALQRGIDIGADEMMGAHVYANEADIGVA
FT                   LRNLVSNAIRYTPDGGKVDLSVHVRDGMAWIEVVDSGPGIDEAQLPRVFDRFFRANTQI
FT                   EGSGLGLSIVQAIANRYGGAVTLRNRTDGQSGIVASIGFAAVP"
     atgtccatgc ccaagatccg ctcgctcaga aatcaactcg tgctcgcgtt gtgcgtgctg        60
     gtgagcgtcg tcggcgtggt gcagggcatc agttcgtggc agctcgcgaa agcgggcatg       120
     agcgcgctgc tcgatctgcg tctcgaacag gcggcgtcgc ggctgtacaa gagcgggctc       180
     gccgaatcgc tgcccgccat tccgtcacgt ggctcacaac cggaacgcga tatctacgtc       240
     acggtctgga gagacgacat cgccacgccg tatcgctcca cggatcccgc gctcgccttg       300
     ccgcgcgacg ccgatccagg cttcacgacg gcaatggtgg gcggcgaaag ctggcgcatt       360
     tacacgctgc gcgaaccgtc gatggtgatc caggtcgcgc agcgctcgcg cgtgcggcac       420
     gaactcgcgc aggcgcgctc gctggatacg ctgtggccga tgatcgtgct ggtgccgctg       480
     gtctggattg ccgtgctgct cgtcgtgcgg cgcgcgttgc gccgcttgac gcgcctcggc       540
     gcgcaggtca aggcgatcga catgacgcat ttcgagcaac tgtccacctc gggcgtgccg       600
     acggagatcc gcccgttcat cacgtcgatc aacacgatga ttgggcgtct cgaacagtcg       660
     atcgaaagcg aacgcaaatt catctccgac gccgcacatg aactgcgcac gccgctcacc       720
     gcgcttcaat tgcaggcgga caatctgcag ccgcatattg cgcccggcaa tcaggagcgt       780
     tttcgcgagc tgcaaagcgg catccggcgc agcggccggc tgatcgcaca actgctgcgg       840
     ctcgcgcgtg ccgatgcggc gctgaaggcg gatacgctga cgcgcgtcga cgtgtcggcc       900
     gtcgtcgtcg atgccgtggc cgaagtactg cccattgcgt tgcagcgcgg catcgacatc       960
     ggcgccgacg aaatgatggg cgcgcatgtg tatgcgaacg aagccgacat cggcgttgcg      1020
     ctgcgcaacc tggtgagcaa cgcgatccgc tatacgccgg acggcggcaa ggtcgatttg      1080
     agcgtgcatg tgcgagatgg aatggcgtgg atcgaagtcg tcgattcggg gcctggcatc      1140
     gacgaggcgc aactgccgcg tgtgttcgac cgcttcttcc gggccaatac gcagatcgaa      1200
     ggcagcgggc tcggtctgtc gatcgtgcag gcgatcgcga accggtacgg cggcgcggtg      1260
     acgctgcgca atcgcacgga tggacagtcc ggcatcgtcg cctcgatcgg atttgctgcc      1320
     gtgccctga                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page