(data stored in ACNUC29543 zone)

EMBL: CP001044.PE100

CP001044.PE100       Location/Qualifiers
FT   CDS_pept        complement(120298..121407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3209"
FT                   /product="protein of unknown function DUF453"
FT                   /note="PFAM: protein of unknown function DUF453; KEGG:
FT                   rpb:RPB_0878 protein of unknown function DUF453"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3209"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72369"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP2"
FT                   /protein_id="ACC72369.1"
FT                   /translation="MQRPIPCLFMRGGTSRGPFFRAEDLPTDLSTRDRVLLDVMGSPDP
FT                   RQIDGLGGAHPLTSKVGIVRRGSRPDIDLEFLFAQLQPDADTVDTTPNCGNMLAAVVPF
FT                   ALEVGLLAPRGRQTTARVLTLNTGMSCDITVDTPEGRPEYDGSARIDGVPGTAAPVSIN
FT                   FLDTAGSVCSAMLPTGRVRDRIDLGDGRTLDVTCIDNGMPMVLVPAEALDRTGRESVAD
FT                   LNADIELKAELEALRRRCSEAMGLGDTSSKNYPKMCLVSRPVAGGALSTRCFIPHVCHD
FT                   AIGVLAAVTVATACVLDGSVAHDLASTSSGVVKQVSIEHPSGEFSVELEVDATNPHVVK
FT                   RAALLRTARLIMRGEVMVKEKAFELAETR"
     atgcagcgcc ccattccctg cctgtttatg cgcggcggaa cctcgcgagg cccctttttc        60
     cgggcggagg atctgccaac cgacctgtcc actcgggacc gcgtgctgct cgacgtcatg       120
     gggtcgcccg acccgaggca aatagatgga ctcggcggcg ctcatccgtt gaccagcaag       180
     gtcggtatcg tccggcgggg atctcgcccc gatatcgatc tcgagtttct attcgcacag       240
     ttgcagccag acgcggacac ggtagatacg accccgaatt gcgggaacat gcttgccgca       300
     gtcgttccgt ttgcccttga ggtgggattg ctcgcacctc gaggaaggca gacgaccgcg       360
     cgcgttctga cgctgaacac tggaatgtcc tgtgacatca ccgttgacac gccggaagga       420
     cgtcctgaat acgacggttc tgcgcgaatc gacggcgtcc ctggaactgc ggcgccggtg       480
     agtatcaatt tcctcgatac ggccggctcc gtctgctcgg cgatgttgcc cacgggtcgg       540
     gtccgggatc gcattgatct aggcgacgga cgcacgctcg acgtgacctg catcgataac       600
     ggaatgccga tggtgctggt gccggcagag gcgctggacc gaaccgggcg tgagtcggtt       660
     gcagatctca atgccgatat cgagcttaag gctgagctcg aagcgttacg acgtaggtgc       720
     agtgaagcaa tgggtcttgg cgacacatcg tcaaagaact acccaaagat gtgcctcgtt       780
     tcgcgacctg tcgcaggcgg agcattatcg acgcgctgct ttattcctca tgtctgccat       840
     gacgctatcg gtgtgctagc ggccgttact gtcgctactg cctgtgtact tgatggcagt       900
     gtcgcgcacg accttgcctc tacatcaagt ggcgttgtca agcaggtatc gatcgaacat       960
     ccatccgggg agttcagtgt tgaactggaa gtcgatgcca caaatccaca cgtcgttaaa      1020
     cgtgctgcgt tactgaggac ggcgcgactg atcatgcgtg gcgaggtgat ggtcaaggaa      1080
     aaagcattcg aactggcgga gacgcgatga                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page