(data stored in ACNUC29543 zone)

EMBL: CP001044.PE101

CP001044.PE101       Location/Qualifiers
FT   CDS_pept        121524..122444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3210"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pna:Pnap_2034 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3210"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72370"
FT                   /db_xref="GOA:B2JRP3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP3"
FT                   /protein_id="ACC72370.1"
FT                   /translation="MELRQLEYFVHVAELGSFTRAANLLSIAQPVLSRQVRALELEFRQ
FT                   VLLERNGRGVTLTEPGRRLLEHSRSILSQVQRVHSDMEDERGEATGRLVVALPPSVSSV
FT                   LSAPLVRRFRECFPKATLCILEGLSAYALEWLTMGRADCAIVYTNSTSPSVELSPVLSE
FT                   QLYLVSSRSAPLSSEDLLAGKPVSLAEVAQKQLVMPSRPHSIRLLLEAAMAQASLKPCI
FT                   ALEIESIPAILNLVHDEELHAVLSLKAVHSDGQQQEFLVRPIEDPPLHITLWIATSAQR
FT                   PRGPLLELAIPVLRQLLCDLWRTRL"
     atggaacttc gtcaacttga atatttcgtc cacgttgccg aattgggcag cttcacgagg        60
     gcagcgaacc tgctttcgat cgcgcaaccc gtcttgagtc gtcaggtgcg tgcgcttgag       120
     ttggagtttc ggcaggtgct tcttgaaaga aacgggcgcg gagtcacgct tacggaaccc       180
     ggaaggcggc tacttgaaca tagccggagc atcctttcgc aggtccaacg cgtccattca       240
     gacatggaag acgaacgcgg agaggcgaca ggaaggctcg tggtagcctt gccgccgagc       300
     gtaagttccg tgttgtctgc gcctttagtt cggagatttc gcgaatgttt cccgaaggcg       360
     acgctttgta tccttgaggg cctctcagcg tacgcgctgg aatggttaac catggggcgc       420
     gcggactgcg ctatcgtcta cacaaattcg acttccccga gcgtcgagct gtccccggta       480
     ttgagtgagc agttgtacct ggtctcgtcc cgctcggcgc ctctctcatc agaagatttg       540
     ctggcgggga aacccgtcag ccttgcggaa gtggctcaaa aacagcttgt catgccgagc       600
     cgtccacatt cgattcgcct tctgctggag gctgcaatgg ctcaggcatc gttaaagccc       660
     tgcattgcgt tggagatcga aagcattccc gccattctca atctcgtgca tgacgaagag       720
     cttcatgcag tgctttcgct gaaggccgtg cactcagatg ggcaacaaca agagttcctt       780
     gtgcgcccta tcgaagatcc tccgcttcac ataacgctat ggattgcgac gtcggcgcag       840
     cgcccacgag gccccctgct cgaactggcc ataccggttc ttcgtcagtt gctgtgtgac       900
     ctgtggcgga cgcggctttg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page