(data stored in ACNUC29543 zone)

EMBL: CP001044.PE103

CP001044.PE103       Location/Qualifiers
FT   CDS_pept        complement(124510..125763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3212"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   swi:Swit_4805 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3212"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72372"
FT                   /db_xref="GOA:B2JRP5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP5"
FT                   /protein_id="ACC72372.1"
FT                   /translation="MSDPAASNHQKIESALVDPPVERGWSRAGIVAALPILAIVLVGIA
FT                   GHATSSLKPLIIQAFVQSVGFDKATSGYLLTVEMISTSAGSIVATAFPFALRRRGYLFG
FT                   ALALMMVANLVSISFKSDPGTMLYALRCLSGFGAGFGLGRLGILIALSGRPGKTAALYS
FT                   TSTQLYGAAAAFAMPFIDRLCGANSIFVILAGTVPLALVLIGWVPESNAKVEKKKAIST
FT                   STPHALGLGEKLILAITFGVFYLGVGTFWPFISVLGETAAIGHTQMSSLLGWAAIASAV
FT                   GSGTAVFAGDRKASAPIITLFFIALCLSVVMQLAVPQSLFIFVTSVLLFAFAYWVINPM
FT                   ILGVMSKLDTTGQMNGVYYIVAVGGISLGPALAGWVLTHGSERSTSTEFLRAVSLALLG
FT                   VSSAVQIYYAFRARRLPD"
     atgagcgacc ctgcagcaag caatcatcaa aaaatcgagt ctgccctagt tgaccctccg        60
     gtcgaacgtg ggtggtcgcg tgcgggcatc gtcgcagcgt tgccgatatt ggcgattgtg       120
     ctggtcggca tcgctggcca tgcgacctca tcccttaagc cgttgattat ccaggccttc       180
     gtgcagtcgg ttggctttga caaggcaaca tcaggctacc tcttgacggt cgagatgatt       240
     tcgacaagcg ccggtagcat tgtggcgacg gcatttccgt ttgctctgcg acgtagaggc       300
     tatctgttcg gcgctctcgc cctgatgatg gttgccaatc tggtcagtat ttcgttcaag       360
     agtgatccgg ggacgatgct ttacgcgtta cgttgcctgt ccggcttcgg tgcgggcttt       420
     ggtcttgggc gtcttgggat ccttatcgcg ttgtcgggcc gtcctgggaa gaccgctgcg       480
     ctctactcaa caagcacaca gctttacgga gccgccgccg ccttcgcgat gccgttcatt       540
     gatcgattgt gcggagcgaa ttcgatcttt gtcattcttg cagggaccgt cccgcttgcg       600
     ttggtgctga ttggatgggt accggaaagc aacgcgaagg tcgagaaaaa gaaggcaatc       660
     tcgaccagca cgccgcacgc gctagggttg ggtgagaaat tgattcttgc gatcactttc       720
     ggcgtgtttt atctcggcgt cggaactttt tggcccttca tctcggtcct cggcgagact       780
     gctgcaattg gccatactca aatgtcgtcc cttcttggct gggctgctat cgccagtgca       840
     gtgggatccg gaacggcggt tttcgccgga gatcggaagg catctgctcc tattattacg       900
     ctgtttttca ttgcgctttg tctttccgtt gtgatgcagc ttgcggttcc ccaatcgttg       960
     ttcatttttg taacctcagt attgctgttc gcgtttgcct actgggtcat caatccgatg      1020
     atcctgggcg tgatgtcaaa gctcgatacg accggacaga tgaacggcgt ttattacatc      1080
     gtcgccgtcg ggggcatttc cctcggaccg gctttggcgg gatgggtgct cacgcatggg      1140
     agtgaacgat ccacaagcac tgagtttctc cgcgctgtaa gccttgccct gctgggagtt      1200
     tcctcggcag tgcagattta ctatgcattc cgtgcgcggc gcctaccaga ctag            1254
//

If you have problems or comments...

PBIL Back to PBIL home page