(data stored in ACNUC29543 zone)

EMBL: CP001044.PE106

CP001044.PE106       Location/Qualifiers
FT   CDS_pept        complement(127913..129148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3215"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS00896 probable transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3215"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72375"
FT                   /db_xref="GOA:B2JRP8"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP8"
FT                   /protein_id="ACC72375.1"
FT                   /translation="MELHGHDYWQRNLAICLFGSFSTVFAMTLILPFLPIYVEQLGVRG
FT                   HKAVVQWAGIAYGANFLAAGLIAPLWGYLGDRFGRKPMLVRASFGMALTMPLMGLSTNI
FT                   WQFVGLRLLAGIAGGYSSGATILIAVQTPRDRLAWALGLLASGVMAGNLLGPLAGGALP
FT                   SLIGIRATFWAAGGLIFIAFVATAFFVREAPLRSEATRNSGEKGWSQLPNKGVVVIMLA
FT                   TGLLLMVANMSIEPIITVYVATLVNNADGVTSVSGPNSAHVTAVAGFVMAAAALGSIVS
FT                   ASQLGKIADRVGHSTVIIMALTTAGLLLIPQAFVTKEWELVLLRFLMGLALGGLLPCIT
FT                   AVIRHNVPDNLVGTVMGYSLSAQFAGQVAGPLIGGFIGGQIGIRAVFLGTCFVLLVGAV
FT                   WNWKTIGFSRRD"
     atggaattgc acggtcacga ctactggcaa cgcaatcttg ccatctgtct ttttggctca        60
     ttctcgaccg ttttcgcgat gacgctgatc ctgccgttcc ttccgatcta cgtcgaacaa       120
     ctgggagtcc gaggtcataa ggcagtcgtg caatgggcgg gaattgcata tggtgccaat       180
     tttctggctg ccgggcttat tgctccgctc tggggatacc ttggagatcg tttcggacgc       240
     aaaccgatgt tggttcgtgc gagtttcgga atggcactga caatgcccct gatggggctg       300
     tccaccaaca tatggcagtt cgtggggttg cgattgctgg cggggattgc cggtggctac       360
     tcgtctggcg caaccatcct tattgccgtt cagacaccaa gggaccgcct tgcttgggct       420
     ctcgggctac tcgcgtctgg cgtgatggct ggtaatctgc tcgggccatt ggcaggggga       480
     gcacttccat cgttaattgg gatcagggca actttttggg ctgcgggtgg gctgatcttt       540
     atcgccttcg ttgccacggc attttttgtt cgcgaggcac cacttaggtc ggaggccacc       600
     agaaattcag gcgaaaaagg atggtcgcaa ctaccgaata agggagttgt agtgatcatg       660
     ctggccactg gtcttctttt gatggtcgcg aacatgtcga ttgagccgat catcaccgtc       720
     tatgtcgcca cgcttgtcaa taatgccgac ggtgtgacct ccgtgagcgg tccaaacagc       780
     gcccacgtca ctgccgttgc tggcttcgtt atggcggccg cggcgctagg aagcattgtc       840
     tcggcctcgc agctgggcaa gatcgccgac cgcgttggac attcaactgt gatcatcatg       900
     gctctcacga ccgcaggcct gttgctcata cctcaggcat tcgtgaccaa ggagtgggag       960
     ctcgtcttac tccgtttcct gatggggctg gctctgggcg ggctcctgcc atgcatcacc      1020
     gctgtgattc gacacaatgt ccccgacaat ctggttggga ccgtcatggg ctattcactg      1080
     tccgcacagt ttgctggtca ggtggctggt ccattgattg gagggttcat cggaggccag      1140
     atcggaatca gagcggtgtt tcttggaacc tgcttcgtgc tgctggtcgg cgcggtatgg      1200
     aactggaaaa cgatcggctt ttccaggcgt gactag                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page