(data stored in ACNUC29543 zone)

EMBL: CP001044.PE107

CP001044.PE107       Location/Qualifiers
FT   CDS_pept        129243..129896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3216"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: rso:RS00895 probable transcription regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3216"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72376"
FT                   /db_xref="GOA:B2JRP9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP9"
FT                   /protein_id="ACC72376.1"
FT                   /translation="MMTQSQLVEDRLRRMILDMDLGPGERLTERSLEELLQTSRTSVRT
FT                   ALFRLEAEGLVSRNGRAWLVPPIDLEEVRQLFDYREILEVAAIQLGGPAATPSELAEMH
FT                   TILNSIDMNSTPEQRAEASRQFHLKIGGLAKNEFVTRSIADCMNRLLRVRWIEIDNADA
FT                   GWTEHRAVLQALQDGNVGHAIALTKNHIGAARERLTSALTARPRTLRARGIVVS"
     gtgatgactc agagccagct ggtcgaagat cggcttcgga gaatgatcct ggacatggac        60
     cttggtcccg gagagcggct aaccgaacga tcccttgagg aactactaca gacctcacgc       120
     acgtctgtgc gaacagcgtt attccggcta gaagcggagg gacttgtaag ccgcaacggc       180
     agggcgtggc tcgtcccccc tatcgatctt gaggaagtta gacagctgtt tgactatcgt       240
     gagattctcg aagtcgctgc gatccagctc ggcgggcccg cagctacccc ctcggagctc       300
     gctgaaatgc acacgatcct caactcaata gatatgaatt ccacgcccga gcagcgcgct       360
     gaggcgtcgc gccaattcca tctcaagata ggcgggctgg ctaaaaatga attcgtgacg       420
     cgaagtattg cggattgcat gaaccgctta cttcgcgttc gctggattga gatcgacaat       480
     gctgacgccg gatggacgga acaccgagct gtcctgcaag ctctgcaaga cgggaatgtg       540
     ggccatgcga tcgcattgac caagaaccac ataggcgccg cacgagagcg gttaacgtcg       600
     gcactcactg cgcgaccgcg aaccttgcgc gcgcgcggaa tagttgtttc atga             654
//

If you have problems or comments...

PBIL Back to PBIL home page