(data stored in ACNUC29543 zone)

EMBL: CP001044.PE108

CP001044.PE108       Location/Qualifiers
FT   CDS_pept        130203..130655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3217"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: sco:SCO7639
FT                   MarR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3217"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72377"
FT                   /db_xref="GOA:B2JRQ0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRQ0"
FT                   /protein_id="ACC72377.1"
FT                   /translation="MNVDRNPVAELTSVSELAFELRETLGRGARLIRVESGPPLSQLTV
FT                   LGHLQRKGAMSTNDLAAAERVRPQSMSLTVQALEKAGLVGRKPHPTDGRATLVQLTRKG
FT                   TKTLESIFATREDWLTSVIVEQLTDDERQELHRGLALIQRIIHNRE"
     atgaacgttg atcgaaatcc cgttgcggaa ctgacgtcgg tctcggagct cgcattcgag        60
     cttcgggaga ccttgggaag aggtgcaaga ctgatccggg tcgagtctgg tcccccactg       120
     tcgcaactta cggtgttagg ccatctgcaa cggaaaggtg caatgagtac gaacgatctt       180
     gccgcagcag aacgcgtccg tcctcaatca atgtcactga ccgtccaagc gctggagaag       240
     gccggtctgg tcggccgcaa accgcatccc actgacggtc gagccaccct cgtccagttg       300
     acgcgtaaag gcactaaaac cttggagagc atttttgcga cccgagaaga ttggttgacg       360
     tccgtaatcg tcgaacagct gacggacgac gaacgtcagg aactacatcg aggattggcc       420
     ctcattcaga gaatcatcca caaccgggaa tag                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page