(data stored in ACNUC29543 zone)

EMBL: CP001044.PE11

CP001044.PE11        Location/Qualifiers
FT   CDS_pept        complement(8881..9189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3112"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3112"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72280"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR54"
FT                   /protein_id="ACC72280.1"
FT                   /translation="MKTLIRTAAAAIALALPIATFAQSNAPVTRAGVLAQVVQPDSAGD
FT                   DPAGGNAHYPAAIEAAQARIDARQTDEYGGVTGGTSQAGAPFHPQYDAGLKSIYVGH"
     atgaaaacgc tgattcgcac ggctgctgcc gctattgcgc tggcgttgcc catcgccaca        60
     ttcgcgcagt cgaacgcacc cgtcacccga gcgggcgtcc tcgcgcaggt tgtgcagccc       120
     gacagcgcgg gcgacgaccc ggcgggcggc aacgcgcact atccggccgc catcgaagcc       180
     gcgcaggcgc gcatcgatgc gcggcagacg gacgaatacg gcggcgtgac aggcggcacg       240
     tcgcaggcgg gcgcgccttt tcatccccaa tacgacgccg gattgaagtc gatctatgtc       300
     gggcattga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page