(data stored in ACNUC29543 zone)

EMBL: CP001044.PE118

CP001044.PE118       Location/Qualifiers
FT   CDS_pept        complement(142181..143737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3227"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; Cache type 2 domain protein;
FT                   KEGG: bxe:Bxe_B2237 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3227"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72387"
FT                   /db_xref="GOA:B2JRR0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRR0"
FT                   /protein_id="ACC72387.1"
FT                   /translation="MIRMTLNQKLSSMMAVLWMGLVLIAVAGVWQYRTALIQDRRDQLK
FT                   TVVQQGESVVKHYYALTQKNAMSDDEARRRTLEALSIMRYGKDGYLTVNDSRPVMLMHP
FT                   FAPDLVSKDQSGFADPTGKHLFQELVKVSNKDGGGFVDYVWYRPGGSRDTPVQKTSYAL
FT                   RFAPWDMIIVTGMYMDDVNAEFTSSLVRWVGLTGVLGLVASAVMFLVLRSVRRGLGGDL
FT                   EVAIETAHRISRGDLTTNVSTAERDTGSLMHALAIMQSGLTEAVERIRLGAENINVGAN
FT                   EIAAGNMDLSQRTEEQAAALVQTASSMDQMTANVRLNADSAEQASRLAGQAAEVAIRGS
FT                   SVVDDVVRTMGEITFSSQRIGDIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVA
FT                   SEVRSLAQRSAMAAKEIKALIESSTSTVDEGAALVANAGETMGEIVRSVQRVSQILGEI
FT                   SHASQEQSSGIEQVNRAMAEMDKVTQQNAALVEEAAAAAQSLKDQAGALRDAISGFALP
FT                   A"
     atgatcagga tgacactaaa tcaaaagctc agctcaatga tggctgtgct gtggatgggc        60
     ctggtcctga tcgccgtggc gggggtatgg caataccgaa cggcgttaat ccaggaccgc       120
     cgcgatcagt tgaaaacagt cgtccagcag ggagaaagcg tcgtcaaaca ctactatgcg       180
     ctcacgcaga agaacgccat gagtgacgac gaggcgagaa gacggacgct cgaggcgctt       240
     tctatcatgc gctatgggaa ggacggatac cttacggtca acgactctcg acctgtcatg       300
     ctcatgcatc cgttcgcgcc agatctcgtc agtaaagacc agtctggttt tgcggacccg       360
     accggcaaac atctctttca ggaacttgta aaagtcagca acaaggacgg ggggggcttc       420
     gttgactacg tctggtacag gccaggcggc agccgggaca cgccggtgca aaagacctcg       480
     tatgcgttgc gattcgcacc ttgggacatg attattgtta ccggcatgta catggacgat       540
     gtgaacgccg agttcacaag ttcgctcgtc cggtgggtcg gtcttaccgg cgtactcgga       600
     cttgtcgcta gcgccgtgat gtttcttgtg cttcgtagcg tgcggcgtgg actaggaggc       660
     gatctcgagg tcgcgatcga gacagcgcat cgcatctccc gcggtgatct tacgaccaac       720
     gtatcgaccg ccgagagaga tacgggcagc cttatgcatg cgctagcgat aatgcaatcg       780
     ggactgacgg aagctgtcga gcgcatccga ttaggtgccg agaatatcaa cgtcggggcg       840
     aatgaaattg ccgccggcaa tatggatctt tcgcagcgca cggaggagca ggccgcagcg       900
     ctcgttcaaa cagcttccag catggatcag atgacggcca acgtgagact taatgctgat       960
     agcgcagagc aagcctcaag gcttgccggg caggcagcgg aagtcgccat acgcgggagc      1020
     agcgtggtcg atgacgtcgt gcgcacaatg ggtgaaatta cgttcagctc ccagagaatt      1080
     ggcgacatca ttggcgtgat cgacggaatt gcgttccaga ccaacattct ggcgctcaac      1140
     gcggccgtcg aggctgctcg agcgggcgag caaggccgtg gatttgccgt cgtagcatca      1200
     gaggtgcgaa gcctcgcgca acgctcggca atggccgcca aggaaatcaa ggcgcttatc      1260
     gaatcctcca caagcaccgt cgacgaaggc gctgcgcttg tcgctaacgc aggcgagact      1320
     atgggcgaga ttgtgcgatc tgtgcagcgc gtcagtcaga ttctcgggga aatcagtcat      1380
     gcatctcaag agcaaagctc gggtattgag caggtgaatc gggcgatggc cgaaatggat      1440
     aaagtgacgc aacaaaacgc tgccctggtg gaagaggcgg ccgctgcggc gcagtctcta      1500
     aaggatcaag ccggcgcgct tcgcgatgca atctcggggt ttgcgctccc tgcttaa         1557
//

If you have problems or comments...

PBIL Back to PBIL home page