(data stored in ACNUC29543 zone)

EMBL: CP001044.PE119

CP001044.PE119       Location/Qualifiers
FT   CDS_pept        complement(143989..145335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3228"
FT                   /product="putative enzyme of poly-gamma-glutamate
FT                   biosynthesis (capsule formation)-like protein"
FT                   /note="KEGG: sit:TM1040_3117 putative enzyme of
FT                   poly-gamma-glutamate biosynthesis (capsule formation)-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3228"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72388"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRR1"
FT                   /protein_id="ACC72388.1"
FT                   /translation="MSRVSVLATGDAMLTQRISPNPDADFLALVEMLRKTDVTITNVEM
FT                   VFPGRGRMASTTMHGIPCGVEPELLSEFEWLGIDIYGMGHNHATDYGVSGLVASIEALE
FT                   ARGLTYAGVGRTLQEARAPRYFDAPGCRVAYIAAGSSNARLCLAADPSVGDVGRPGTAP
FT                   LRVQKTHYIRKERFDELREILAEAGVNVSATGTTAPGIHFPYPDKNIYDGPPPGGFAVE
FT                   GVNFAPGDDSRVQTDVLERDVDAIVASVKEASRQADLVFVGLHCHEGIQGRWNTEVPAE
FT                   FLQPLAHQLIDAGAHGVFAHGPHMLRGVEFYAGRPICYSLGNFIFNVETFSSFPLEVYE
FT                   QQGMPLSSTPADLFDVVTGYKNQPLFWESVVARFTFENGLLADSELHPITLGRDAPRSR
FT                   RGCPELASAEEGARILGRLNELSKPFGAALDIVRDGERCVGKIKFRVSD"
     gtgtcaagag ttagtgtcct tgcgacgggc gatgccatgc tcactcaacg gatctcgccc        60
     aatcccgatg cggatttcct agcgcttgtc gagatgctac ggaagacgga cgtgaccatc       120
     accaacgttg agatggtctt cccgggccga ggcagaatgg cctcgaccac aatgcatggc       180
     attccgtgcg gtgtagagcc tgaacttctc tcagaatttg agtggctcgg tatcgatatc       240
     tacggaatgg ggcacaatca cgcgaccgac tacggcgtat ctgggctggt tgcctcgatt       300
     gaagcattgg aggcacgtgg tttgacctat gcaggggtcg ggagaaccct gcaggaggcg       360
     cgtgctccgc gctatttcga tgcaccgggt tgccgtgtcg catatattgc ggccggatcg       420
     agcaacgctc gtctgtgtct cgcggcggac ccgagcgtcg gcgatgtggg gcgtcccggt       480
     actgcaccgc ttcgtgtgca aaaaacccat tacatcagga aggagcggtt cgacgaactg       540
     cgagagatcc tggcggaggc aggcgtcaat gtctctgcga cgggaacgac tgcccctggt       600
     attcacttcc cctatcccga caagaacatc tacgatggac ctccgccagg agggtttgcg       660
     gtcgagggcg taaattttgc tccgggcgac gattcgcgcg tgcagactga cgtgctggag       720
     cgcgacgtcg atgcaatcgt tgcctccgta aaagaagcgt cgcgtcaggc agacctcgtt       780
     tttgtcgggt tgcattgtca tgaaggcatc caaggccgct ggaacactga ggtacctgca       840
     gagtttctgc agccgctcgc gcatcaattg atcgacgccg gtgcacacgg agtcttcgcg       900
     catggaccac acatgctgcg gggcgtggag ttctatgccg gccgcccaat ctgctattca       960
     cttggcaact tcatcttcaa cgtggagacg ttctcgtctt tcccgcttga ggtctacgaa      1020
     cagcagggca tgccgctatc ctccacgcct gcagatctgt ttgacgtcgt gactggttat      1080
     aagaaccaac cgctgttttg ggagtcggtg gtggctcgct ttacctttga gaatggcttg      1140
     ctagccgata gcgaactaca tccaatcaca ctcggacgcg atgcgccgag aagtcgtcga      1200
     ggatgccctg aacttgcgtc tgcagaagag ggtgcccgga ttcttggccg cctgaatgag      1260
     ttgtcgaaac catttggtgc cgcgctcgat attgttcgcg atggtgagcg atgtgtcggc      1320
     aagatcaagt tcagagttag tgactga                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page