(data stored in ACNUC29543 zone)

EMBL: CP001044.PE120

CP001044.PE120       Location/Qualifiers
FT   CDS_pept        complement(148252..149355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3230"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   rme:Rmet_4228 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3230"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72389"
FT                   /db_xref="GOA:B2JRR2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRR2"
FT                   /protein_id="ACC72389.1"
FT                   /translation="MRGVDTFTENLFSVRKLDDFVPTSHPLRSIRVMANEALAKMDRIF
FT                   AGMYEADIKGGRPSIAPEKLLRAMLLQVLYSIRSERQLMEQTQYNLLFRWFIGLSMDDS
FT                   VWVPTVFTKNRERLIRHDAVVEFFNEVLSIAQKKNWLSGEHFSVDGTLIHAWAGHKSFV
FT                   RKDGEEDRDNDGGSGEGGFKGSKRSNETHESKTDPDARLYRKGKTASELRYMGHTLTDN
FT                   RHGLVVNARVSRADGHAEREAAKVMINDARQAANDAAAQITLGADKGYDAQEFIEACQQ
FT                   MKVTPHVAQNTSGRRSAVPDAIARSVGYAISQQKRKLIEQGFGWAKTVGRMRQVMVRGL
FT                   KKVDQMFVLNMAAYNLVRMRSLGQARP"
     atgcgcggcg tcgacacgtt caccgagaat ctgttttccg tgcgcaagtt ggacgatttc        60
     gttccgacct cgcatccgct gcgctcgatt cgcgttatgg cgaacgaagc gctggcgaag       120
     atggatcgga tctttgccgg gatgtatgag gccgacatca agggaggccg gccgagcatc       180
     gcgccagaga agctgttgcg tgcgatgctg ctgcaggtgc tatacagcat ccgatccgag       240
     cgtcagctca tggagcaaac gcaatacaac ctgctgtttc ggtggtttat cggtctgtca       300
     atggatgatt cggtctgggt gccgacggtg ttcacgaaga accgcgagcg attgatcagg       360
     cacgatgcgg tggtcgaatt tttcaacgaa gtgctgtcca tcgcgcagaa gaagaactgg       420
     ctgtcgggcg agcactttag cgtcgacggc acactgatcc acgcatgggc aggacacaag       480
     agttttgtgc gcaaggacgg tgaagaggac agggataacg acggtggcag cggcgaggga       540
     ggcttcaagg gtagcaagcg aagcaacgaa acgcacgagt cgaagaccga tcccgatgca       600
     cggctttacc gcaagggcaa gacggccagc gaattgcgtt atatgggcca cacgctgacc       660
     gacaaccgcc acgggctggt ggtcaacgcc cgcgtgagtc gcgctgacgg acacgcggaa       720
     cgtgaagcgg cgaaggtcat gatcaatgat gcgcggcagg cagcgaacga tgcagcggca       780
     caaatcacac tgggtgcgga caagggttac gacgcacagg aattcatcga agcttgccag       840
     cagatgaagg tcacgccgca cgtggcacag aacacctccg gccgccgttc ggcggtgccc       900
     gatgcgattg cgcgcagcgt cggctacgcg atatcgcagc aaaagcgaaa gctgatcgaa       960
     caaggttttg gatgggcgaa gactgtgggg cgcatgcgtc aagtgatggt acgcgggttg      1020
     aagaaagtcg accaaatgtt tgtgttgaac atggccgcgt acaacctcgt gcgcatgcgt      1080
     tcgctaggac aggcacgccc gtaa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page