(data stored in ACNUC29543 zone)

EMBL: CP001044.PE124

CP001044.PE124       Location/Qualifiers
FT   CDS_pept        complement(153893..154384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mav:MAV_4187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3234"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72393"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS16"
FT                   /protein_id="ACC72393.1"
FT                   /translation="MANALYSTRTILIEHVTIKSIKPFEEVRAKLVALAPRIDDGIFTL
FT                   LRYGESTRALRELEACPPLTIFGQRDHGALLAIAGLTRRSIQYDIGNPLTASKMTRHQL
FT                   SAVLYAPIRVLLREDGDGGVGFEYDRPASVFGQFGSEEVNTVAQQLDRDLQTLLEAAAN
FT                   "
     atggccaatg cactgtactc cacgcgcacc attttgattg agcacgtcac aatcaaatcg        60
     ataaagccat tcgaggaagt tcgagccaag ctcgtggcct tggcgcctcg catcgatgac       120
     ggcatcttca cgcttctgcg atacggcgaa agcacgcgcg cgcttcgaga gttggaggca       180
     tgtccgccac tcactatttt cggccagcgt gaccacgggg cgctgctggc tattgctggg       240
     ctgacgcgcc gatccatcca gtacgatatc ggcaatccgc tcaccgcatc gaagatgacc       300
     cgccatcaac tgtcggcggt actctatgca cccatccgtg tgctgctgcg cgaggatggc       360
     gatggcggtg tcgggtttga atatgatcga ccagcctccg ttttcggcca gttcggcagc       420
     gaggaggtca ataccgtggc tcagcagctt gatcgcgacc tccaaacctt gttggaggcg       480
     gctgcaaact ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page