(data stored in ACNUC29543 zone)

EMBL: CP001044.PE128

CP001044.PE128       Location/Qualifiers
FT   CDS_pept        complement(159818..161092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3239"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   bur:Bcep18194_B1028 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3239"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72397"
FT                   /db_xref="GOA:B2JS20"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS20"
FT                   /protein_id="ACC72397.1"
FT                   /translation="MRFDARAAAKLPSGAHMTFEGFPGLRLQASTSRKSWTYRYKSPVD
FT                   SRMRQVKLGEWPAMSFAGAIAAWEKSRVERDSGAELSALRRKPETGTTRPSPDTYSVRQ
FT                   LCRDYLQGYVEVNRKTKGAVEVARIFKAMLGPIADMRAASITRAQAFDLLESYRSTPML
FT                   AARLRMELGGAWHYALDAGRLPENTANWWKEVLRGRLKSKGRKVEGQYTGTQKRVLSVD
FT                   ELGTLIRWLPNFSLTVADALTLYLWTGTRGGEIVAMESTEIADESDGLWWTIPKRKTKG
FT                   LHNEKATDLRVPLVGRAEVIVRRRLDQAKGTVLFPSSRGEAMDQTVVQHGVYYHQPYCK
FT                   IAPNHDRPRLPVTHWSAHDLRRTTRTLLAALGCPNEIAEAVLGHVLPGIIGVYNRHTYD
FT                   RERRQWLTQLSHRLEDIAATYPPKK"
     atgcgcttcg atgcacgtgc cgcagccaag ctgccgagcg gcgctcacat gacctttgag        60
     ggatttcccg ggctgcgctt gcaagcttct acgagccgga aatcgtggac gtatcgctat       120
     aagtcaccag tcgatagccg catgcggcaa gtgaagctcg gtgaatggcc agcaatgtcg       180
     tttgctggag ctatcgctgc gtgggagaag agccgcgtcg aaagggattc gggcgccgag       240
     ctttcggcac tgcgacgaaa gccggaaaca gggactactc gtccatctcc ggacacttac       300
     agcgtcagac agctgtgccg cgattatctg caaggttatg tagaagtcaa tcgaaagacg       360
     aaaggtgcag tcgaggtcgc acgcatattc aaagcaatgt taggtcctat cgcggatatg       420
     cgtgcggctt ccataacgcg cgcccaagct ttcgatctgc tggaatcata ccggtcgacg       480
     ccgatgctcg cagctcgcct tcgtatggag cttggcggcg cctggcacta cgcgctagat       540
     gccggtcgtc ttcctgaaaa caccgctaac tggtggaagg aagttctgag agggcgactg       600
     aagagcaaag ggcgcaaggt cgagggccaa tataccggaa cacagaaaag ggtgctttcg       660
     gttgatgaac ttggcacatt gattcgctgg ctgccgaatt tcagcttgac cgtcgctgat       720
     gcattgacgc tctacctctg gactggcacg agggggggtg agattgtcgc tatggagagc       780
     accgagatcg ccgacgaaag cgatggtctt tggtggacga ttcccaaacg aaagacgaag       840
     gggcttcata acgagaaagc aacggatctg cgcgtgccgc tcgtgggccg cgccgaagta       900
     attgtgcggc gacgcctcga tcaggccaaa gggacggtac tgtttccttc gtcgcgtggg       960
     gaagcgatgg atcagaccgt ggtccagcac ggcgtctatt atcatcagcc gtactgcaaa      1020
     attgcaccga accatgatcg tccgcggttg cccgtgactc attggtccgc ccacgatctt      1080
     cgacggacaa cacgcacgct gcttgcggcg cttggttgtc cgaacgaaat cgccgaggca      1140
     gtgcttggtc atgttctgcc tggaataatc ggcgtctata accgacatac ctacgacaga      1200
     gaacggcgtc agtggctcac gcaactgtca catcgcctcg aagatattgc agctacatat      1260
     ccgccgaaaa aatag                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page