(data stored in ACNUC29543 zone)

EMBL: CP001044.PE138

CP001044.PE138       Location/Qualifiers
FT   CDS_pept        168964..169620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3249"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bxe:Bxe_B1688 ABC
FT                   polar amino acid family transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3249"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72407"
FT                   /db_xref="GOA:B2JS30"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS30"
FT                   /protein_id="ACC72407.1"
FT                   /translation="MIEFTLWDIARNLLLAARWTVLLSLIAFVGGGVVGLLLLAMRVSP
FT                   FPWLRRIVVLYVELFQGTPLLMQLFLAFFGLPLMGVDVSPWVAATVTLTLYTSAYLVDI
FT                   WRGCVEAVPRGQWAAGASLGMTFAQQLRYVVWPQALKIAVAPTVGFLVQVVKSTALTSI
FT                   IGFTELTKTGTMITNAAFRPFPIYGMVAVLYFAMCFPLTWWARLLERKQKATQQR"
     atgatcgaat tcacgctttg ggacattgcg cgtaatctgc tgctcgcagc acgctggacg        60
     gtgttgctgt cgttgattgc gtttgtcggc ggtggcgtcg tgggtttgct gttgctcgcg       120
     atgcgcgttt cgcctttccc ctggctgcgg cgcatcgtcg tgttgtatgt ggagttgttt       180
     cagggcacgc cgttgctgat gcagcttttt cttgcgtttt ttggtttgcc gttgatgggt       240
     gtcgatgtat cgccctgggt tgcggccact gtcaccttga cgctttatac gagtgcgtat       300
     ctcgtcgata tctggcgagg ctgcgttgaa gccgtgccgc gcgggcaatg ggcggcgggc       360
     gcgagtctcg gcatgacgtt tgcacagcag ttgcgatatg tcgtgtggcc gcaggccttg       420
     aagattgctg tcgcgcccac ggttggcttt ctcgtgcagg tggtcaagag cacggccttg       480
     acttcgatca tcgggttcac cgaactcacc aagacgggca ccatgattac gaatgctgcc       540
     tttcggccgt ttcctatcta tgggatggtt gctgttctgt actttgcgat gtgctttcca       600
     ctaacctggt gggcgcggct tttggagcgg aagcagaagg ctacgcagca acgctga          657
//

If you have problems or comments...

PBIL Back to PBIL home page