(data stored in ACNUC29543 zone)

EMBL: CP001044.PE144

CP001044.PE144       Location/Qualifiers
FT   CDS_pept        complement(180297..182861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3255"
FT                   /product="cellulose synthase subunit B"
FT                   /note="PFAM: cellulose synthase subunit B; KEGG:
FT                   bxe:Bxe_B2041 cellulose synthase regulatory subunit, cyclic
FT                   di-GMP binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3255"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72413"
FT                   /db_xref="GOA:B2JS36"
FT                   /db_xref="InterPro:IPR003920"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS36"
FT                   /protein_id="ACC72413.1"
FT                   /translation="MRILRYDAAVAAAMRTGVRLLACSACRLPLRATVGALLFAATLPA
FT                   VQAASASPPGASPGAVPATKAQLAATPGTTPANQPLVAQSTAPAPAGNGLPPLPSAKPV
FT                   DARAAQQPSFAEPAPQTFAAVRSGRDTMPTTADNGTAVSGGRRQTFTFAQLGALDPLQL
FT                   RGVDGQNGVPFSVRADEVVTGANLHLIYSYSPSLLSNLSHLKVLVNGEVAATLPLPREQ
FT                   AGTLLARDIPLEPRLVTEFNHLNIQLIGHYTQGCEDPASSALWATVSNASTLDLTFASL
FT                   ATKPDLGALPLPFFDRRDVRRLELPFVFAAKPSSQALEAAGAVASWFGSLAGYRGALFP
FT                   AQLDNAPLSGNAVVFATNDERPAGVTLPAINGPVLAIVDREAPARGKLLLVMGRDAREL
FT                   KIAANALSLGEAALSGTMQTITHVDAPRARQPYDAPGWLPTDRAVRFGELTVPKDLSVR
FT                   GYNPDVVRVDLRIAPDLFTWRTKGVPVDLRYRYTVRPAPDRSTLNISVNNNFVQALRIP
FT                   AESSSMLDLGRYLNRMLPDHTAPASKEIFIPPHLLASQAQLRFHFYYDMPKTGECQGQV
FT                   LDNVRGEIDPDSTIDLSSFPHYMALPDLAAFANSGWPFTKLADLSQTAVILPANANPSD
FT                   YSLYLMVMGRMGASTAYPVTGVTVATAGDVQRLADKDLLVIGAPGQQPLLSAWEKDMPF
FT                   SAADDTRRMQFSNVSFRIANWWHGNRGGVRTAGRADLSLVNSSGDAIVTGFRSPLEKGR
FT                   SVVALISAPGQSEADLTNAMLDPDLVQSIQGGLTVVRGRTLEVVSNGDVYYVGHLSPVE
FT                   YMRWALSVHPLLLVSGGLLAALIIAAVFYRLLRAVAARRLKD"
     atgcggatct tgcgatacga cgccgctgtt gcagcggcga tgagaacggg tgtgcgtttg        60
     ctggcgtgca gcgcgtgccg gctgccgctg cgcgcgacgg tgggcgcgct gctgttcgcg       120
     gccacgttgc ctgccgtgca ggcggcttcc gccagcccgc cgggcgcttc accgggtgcc       180
     gttcccgcga cgaaggcgca gcttgcggcg acgccaggca cgacgcctgc gaaccagccg       240
     ctcgtcgccc aatcgacggc gcccgcgccc gccggtaacg gcttgccgcc gctgccgtcg       300
     gccaagcccg tcgatgcgcg cgccgcgcag cagccgtcgt tcgccgagcc ggcgccgcag       360
     accttcgccg ctgtgcgcag cggccgcgac acgatgccga ccacggccga caacggcacg       420
     gccgtatccg gcgggcgtcg tcagacattc acgttcgctc aacttggcgc gctcgatccg       480
     ctgcaactgc gcggcgtcga cggacagaac ggcgtgccgt tctccgtgcg cgccgacgaa       540
     gtggtcacgg gcgcgaatct gcatctgatc tacagctatt cgccgtcgct gctgtcgaat       600
     ctgtcgcatc tcaaagtgct cgtgaacggc gaagtggccg ccacgctgcc gctgccgcgc       660
     gagcaggcgg gcacgctgct cgcccgcgac attccgctcg aaccgcgcct cgtcaccgag       720
     ttcaatcacc tgaacatcca gttgatcggc cattacacgc agggctgtga agaccccgcg       780
     agcagcgcgc tatgggcgac cgtcagcaat gcgagcacgc tcgacctgac cttcgcatcg       840
     ctggcgacga agccggatct cggcgcgttg ccgttgccgt tcttcgaccg gcgcgatgtc       900
     cgcaggctgg agttgccgtt cgtgttcgcc gccaagccgt cgtcgcaggc gctcgaagcg       960
     gcaggcgccg tcgcgtcgtg gttcggctcg ctcgcgggct atcgcggcgc gctctttccg      1020
     gcgcagctcg acaacgcgcc gctgtcgggc aacgccgtgg tgttcgcgac caacgatgaa      1080
     cgtccagcgg gagtcacact gcccgccatc aatggtcccg tgctcgcgat cgtcgatcgc      1140
     gaagcgcccg cgcgcggcaa gctgctgctc gtgatgggac gcgacgcacg cgagctgaag      1200
     attgcggcga acgcgctgtc gctgggagaa gcagcgctgt cgggcaccat gcagacgatc      1260
     acgcacgtcg acgcgccgcg cgcacgtcag ccgtacgacg caccgggctg gctgccaacc      1320
     gaccgcgccg tgcgcttcgg cgaactgacc gtgccgaaag acctttccgt gcgcggctac      1380
     aacccggacg tggtgcgcgt cgacctgcgc atcgcgcccg atctgttcac ctggcgcacc      1440
     aagggcgtgc ccgtcgacct gcgttaccgc tacacggtgc gccccgcgcc ggaccgttcg      1500
     acgctcaaca tcagcgtcaa caataacttc gtgcaggcgc tgcgcattcc ggccgagtcg      1560
     tcgtcgatgc tggatctcgg gcgctatctg aaccggatgc tgccggacca cacggcgccc      1620
     gcgtcgaaag agatattcat tccaccgcat ctgctcgcgt cgcaggcgca gctgcgcttc      1680
     catttctatt acgacatgcc gaagacgggc gaatgtcagg ggcaggtgct cgacaacgtg      1740
     cgcggcgaga tcgatcccga ttcgaccatc gatctgtcgt cgtttccgca ctacatggcg      1800
     ttgcccgatc tggccgcgtt cgcgaacagc ggctggccgt ttacgaagct cgccgacctc      1860
     tcgcagacgg cggtgatcct gcccgcgaac gcgaatccga gcgactacag cctgtatctg      1920
     atggtgatgg gccgcatggg cgcgtcgacg gcgtaccccg tgacgggcgt cacggtcgcg      1980
     acggccggcg acgtgcagcg tctcgccgac aaagatctgc ttgtgatcgg cgcacccggc      2040
     cagcagccgt tgctgagcgc ctgggaaaag gacatgccgt tctctgccgc cgacgacacg      2100
     cgccgtatgc agttctcgaa cgtgtcgttc cgcatcgcca actggtggca tggcaatcgc      2160
     ggcggcgtgc gcacggcggg gcgcgcggac ctgtcgctcg tgaattcatc gggcgacgcg      2220
     atcgtcaccg gattccggtc gccgctcgaa aaagggcgca gcgtggtcgc gctgatttcg      2280
     gcgccgggcc aatcggaagc ggatctgacc aacgcgatgc tcgatcccga tctcgtccag      2340
     tctatccagg gcggactgac ggtagtgcgc ggccggacgc tcgaagtggt gtcgaacggc      2400
     gacgtgtact acgtcgggca tctgtcgccc gtcgagtaca tgcgctgggc gctgtccgtg      2460
     catccgctgc tgctggtgtc cggcggcctg ctggcggcgc tgatcatcgc ggcggtgttc      2520
     taccggctgt tgcgcgcggt cgcggcgcgc cggttgaagg attga                      2565
//

If you have problems or comments...

PBIL Back to PBIL home page