(data stored in ACNUC29543 zone)

EMBL: CP001044.PE147

CP001044.PE147       Location/Qualifiers
FT   CDS_pept        complement(185878..186762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3258"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3258"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72416"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS39"
FT                   /protein_id="ACC72416.1"
FT                   /translation="MRRTSRGNIMSVSDDVGNLFRRFGGDAGQYQEVARDDEAKQAALR
FT                   WPLLNALDIAHVGPVPDAGRPGPAAAPGCRPEPAVASPAGRREQPVRATATSTSESTGA
FT                   ARLPLFARGHRHATMPPPVTPARTGANRFSAPPAVAAAPDPAPAAERKKAAANAVRMAA
FT                   APVAAPAAPPVAAAPAAARPVPPVTPAFRVSALHHVAQSDPGPSCSGRRQSFGPAPFTG
FT                   PVPEGTRDTAWQQGGSILSGLFGGKAAPSGALAAAPSKDLSTLFARLSRGPAAPARSLR
FT                   DTLRTRFKADGEA"
     atgcgcagga caagtagagg aaacatcatg agcgtttcag acgacgtcgg taatctgttc        60
     cgacgcttcg gtggcgacgc cgggcaatac caggaagtcg cacgcgacga cgaagcgaag       120
     caagccgcac tgcgctggcc gttgctgaac gcgctcgata tcgcgcatgt cgggccggtg       180
     ccggacgccg ggcgtccggg gccggctgct gcgccgggct gtcgccccga gccggccgtt       240
     gcgtcgccgg cagggcggcg cgagcagccg gtaagggcaa ccgcgacgag cacctcggaa       300
     tccacgggag cggcgcggct gcccttgttc gcgcgcggac atcggcatgc aacgatgccg       360
     ccgcccgtca cgccggcgcg tacgggcgcc aaccgtttca gcgcgccgcc ggccgtcgca       420
     gcggcacccg accctgcgcc cgccgccgag cgcaagaaag cggccgcgaa cgctgtgcgc       480
     atggcggctg ccccggttgc agcacccgcc gccccgcccg tcgcggcagc gccggctgcg       540
     gcacggcctg tgccgcccgt cacaccagct ttccgcgttt ctgcgcttca tcatgtagcc       600
     caatctgacc caggtccctc ttgttcgggc agacgccagt cgtttggccc tgccccattt       660
     acagggcccg tgccggaagg cacgcgcgac actgcatggc agcaaggcgg ctcgattctc       720
     tcggggctgt tcggcggcaa ggcagctcca tcgggagcgc tcgcagccgc gccgtcgaaa       780
     gacctgtcga ctctcttcgc gcgactgtcg cgcggcccgg cggcgcccgc ccgttcactg       840
     cgcgacacgt tgcgcacgcg cttcaaggcg gatggcgagg catga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page