(data stored in ACNUC29543 zone)

EMBL: CP001044.PE150

CP001044.PE150       Location/Qualifiers
FT   CDS_pept        188143..188961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3261"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bxe:Bxe_B1693
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3261"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72419"
FT                   /db_xref="GOA:B2JS42"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS42"
FT                   /protein_id="ACC72419.1"
FT                   /translation="MTQWILDQELTYCGQAVRYRTFGEGPPVVLIHGTPFSSFVWHRIA
FT                   PHLARDRKVHVYDLLGYGQSERRDGQDVSLGVQNGLLAALLDHWQLDAPDVIAHDFGGA
FT                   TALRAHLIDGCDYASLTLIDPVAVAPWGSPFVRHVREHAAAFEGLPAYIHEAVVNAYIR
FT                   GSIARTIAAHELAPYVSPWLGEVGQPAFYRQIAQMDQRYTDEIEARYPQVRCRTQILWG
FT                   ENDQWIPIERGRHLAGVIPDARFEPVPNAGHLVQEDAPEAVVAAVLRWIG"
     atgacgcagt ggatactcga tcaggaactc acgtattgcg gtcaggccgt acgctatcgc        60
     actttcggcg agggaccgcc cgtcgtgctg attcacggta cgcccttttc atcgttcgta       120
     tggcatcgga ttgcgccgca tctcgcgcgc gatcgcaagg ttcatgtgta tgacctgctc       180
     ggctatgggc aatctgaacg gcgcgatggc caggacgtct cgttgggcgt gcagaacggc       240
     ttgctcgccg ccctgctcga ccactggcaa ctggacgcac cggatgtcat cgcgcatgac       300
     ttcggcggcg cgacggcgct gcgcgcgcat ctgatcgacg gctgcgacta tgcgagcctc       360
     acgctgatcg atcccgtcgc cgtcgctccg tgggggtcgc cgttcgtgcg acacgtgcgc       420
     gagcatgcag cggctttcga ggggctgccc gcttatattc acgaggccgt cgtcaatgcg       480
     tacattcgcg gttcgatcgc gaggacgatc gcagcgcacg agctcgcgcc ttatgtgtct       540
     ccgtggctcg gcgaagtggg gcaacccgcc ttctaccggc agatcgccca gatggatcag       600
     cgctacaccg atgaaatcga agcgcgctat ccgcaggtgc gctgccgcac gcagatcctg       660
     tggggcgaga acgatcaatg gattccgatc gaacgcggca ggcatctggc gggcgtcatt       720
     cccgatgcgc gcttcgagcc cgtgccgaac gccggccatc ttgtgcagga agacgcgccc       780
     gaggccgtcg tcgccgctgt gttgcgctgg atcggttga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page