(data stored in ACNUC29543 zone)

EMBL: CP001044.PE164

CP001044.PE164       Location/Qualifiers
FT   CDS_pept        complement(204356..204793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3277"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: pfo:Pfl_3845 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3277"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72433"
FT                   /db_xref="GOA:B2JS56"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS56"
FT                   /protein_id="ACC72433.1"
FT                   /translation="MVINDILVTCTGNICRSPTAEIILRHRLAARSISVTSAGISALVG
FT                   RPICDKAAEILAENGHSSVTHRAKQVTPTMLRQSDLILTMSHRQRNHICSMMPEVRGKV
FT                   FLLGKWDAGIEIPDPYRRDRRRYEHIYGLIEKTVESWLMHL"
     atggtgatca acgatatcct ggtgacttgc acgggaaaca tatgtaggag cccaaccgcc        60
     gagatcatcc tgcgacaccg actggcggca aggtcgatct ctgttactag cgcagggatt       120
     agtgcactag tagggcgccc gatatgtgat aaagccgcgg aaattttggc ggaaaacgga       180
     cattcgagcg tgacgcatag agcgaagcag gtcactccaa ccatgcttcg gcaatccgat       240
     cttattttga cgatgagtca ccgtcagcgt aaccatattt gctcgatgat gccggaggtt       300
     agggggaaag tgtttctgct cggaaagtgg gacgcgggaa tcgaaattcc agatccgtac       360
     agacgagacc gtcgtcgata tgagcatata tatgggttga tcgaaaagac agtcgaaagt       420
     tggttgatgc acttatga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page