(data stored in ACNUC29543 zone)

EMBL: CP001044.PE166

CP001044.PE166       Location/Qualifiers
FT   CDS_pept        206229..207485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3279"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72435"
FT                   /db_xref="GOA:B2JS58"
FT                   /db_xref="InterPro:IPR014550"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS58"
FT                   /protein_id="ACC72435.1"
FT                   /translation="MVTPCAISNTHTGSNRTTAPHSRLTETALRAARAPSRRGVLLKKQ
FT                   KKAEKRMQIPKNRLIELDFFRGLVLLFIVVDHIGGSILSRATLHAYALCDAAEVFVFLG
FT                   GFATATAYASLAKRHTEADARNRFFKRSLELYRAFLVTAVLMLVVSAVMSAFSIDAPNM
FT                   ATTDLDDMMDTPTAVLRDILLFRRQPYLASVLPMYAFFAFAVPVILPLARSKPWLLLAG
FT                   SLAVWGIAPSILPHLPVAENAQWDFNPFAWQLMFVLGVIAQTQPVYQRTSAHRYGWLVT
FT                   ALACGIVAAAAWFKLFVEVTPLDSSLKQNLSWLRAMNFLAIAWLVANMVRLGWARTIAQ
FT                   RLPWVGLVGRKGLLCFVAGTVISLVVDSLLYTATDGYLNLPLGLLADAVAIGSLFAVAK
FT                   ASVPISRVLTPRLHGSGPA"
     atggtcacac cgtgcgcaat cagcaacacg cacacaggca gcaaccgcac cacagccccc        60
     cattcccgcc tcaccgaaac cgcgctgcgc gccgcccgcg caccgtctcg gcgaggcgta       120
     ttgctgaaaa agcagaaaaa agcagaaaaa cgcatgcaga ttccgaaaaa ccgtctgatc       180
     gagctggact tcttccgagg gctggttctt ttatttatcg tcgtcgacca catcggcggc       240
     agcatcctgt cgcgcgccac gctccacgcg tacgcgctgt gcgacgccgc cgaagtcttc       300
     gtcttcctcg gcggattcgc gacggccacg gcctacgcgt cactcgccaa acgtcacacg       360
     gaggccgacg cgcgcaaccg tttcttcaag cgctcgctgg agctgtaccg cgcatttctg       420
     gtcacggccg tcctgatgct ggtcgtgagc gccgtcatga gcgccttcag catcgacgcg       480
     cccaacatgg ccacgaccga tctcgacgat atgatggaca cgcctaccgc tgtcctgcgc       540
     gacatcctgc tgttccgtcg ccagccctat ctggcttccg tcctgcccat gtacgcgttc       600
     ttcgcgttcg cggtgcccgt gatcctgccg cttgcgcgca gcaagccgtg gctgctgctg       660
     gcgggcagcc ttgccgtatg gggcattgcg ccgtcgatac tgccgcacct tcccgtggcg       720
     gaaaatgcgc aatgggactt caatccgttc gcctggcagc tgatgttcgt gctgggtgtg       780
     attgcgcaga cacagcccgt ctatcagcgc acgagcgcgc atcgctacgg ctggctggtg       840
     acggcgctcg cgtgcggcat cgtcgcggcg gccgcctggt tcaagctgtt cgtggaagtg       900
     acgccgctcg acagcagcct gaagcagaat ttgtcatggc tgcgtgcaat gaatttcctc       960
     gcgatcgcgt ggctcgtcgc gaatatggtg cgcctcggct gggcgaggac gattgcacag      1020
     cgcctgccct gggtcgggct cgtcgggcgc aagggcctgc tgtgcttcgt cgccggcaca      1080
     gtgatctcgc tggtcgtcga ctcgctgctg tacacggcca ccgacggcta tctgaacctg      1140
     ccgcttggcc tcctcgcaga cgccgttgca atcggctcgc tgttcgccgt cgcaaaggcg      1200
     tccgtgccta tctcgcgcgt gttgaccccg cgtttgcatg gatcgggacc cgcctga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page