(data stored in ACNUC29543 zone)

EMBL: CP001044.PE169

CP001044.PE169       Location/Qualifiers
FT   CDS_pept        complement(209356..210291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3282"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bxe:Bxe_B0824 putative lipase (esterase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3282"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72438"
FT                   /db_xref="GOA:B2JS61"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS61"
FT                   /protein_id="ACC72438.1"
FT                   /translation="MLEPEIVEFVERTKRLYPADRSASTPAEQRAMYERLAAAFTPPLP
FT                   DGVTTQDALFMPPASGQSFMLRLYVPTDRARASGTVLYFHGGGFVVGSLASHELITARI
FT                   AADTGLCVVAVDYRLAPEHPAPAAHDDCLAVTRAALDGSLPFSALPRSLQLAGDSAGGT
FT                   LAASVALRLRDEGVPGVRGLALVYPMLGIEPQLPARDTEADAPMLTLADVRRYGELYWR
FT                   GRPVDTWTVPLEASRYDGLPPTLAIGVEHDPLRDDARVFAERIVAARGRVDAPIGRGLV
FT                   HGAWRALATSPGVQWMHREVCRFLSAHAAD"
     atgctcgaac cggagatcgt tgaattcgtt gaacgtacga agcgtcttta tcccgccgat        60
     cgctccgcgt cgacgcccgc cgaacagcgc gcgatgtacg agcgactggc ggctgcgttc       120
     acgccgccgc ttcccgacgg tgtgacgacg caggatgcgc tgttcatgcc gcccgcgagc       180
     gggcagtcgt tcatgttgcg gctgtatgtg ccgaccgacc gcgcacgcgc atcgggcacg       240
     gtgctctatt ttcatggcgg aggcttcgtc gtcggttcgc tcgccagtca cgaactgatc       300
     actgcgcgta tcgcggcgga tacgggactg tgcgtcgtgg ccgtcgatta tcggctcgca       360
     ccggaacatc ccgcgcccgc cgctcacgac gattgcctcg cggtgacacg cgctgccctc       420
     gatggcagtt tgccgtttag tgcgttgccg cgctcgttgc aactggcggg cgacagcgcg       480
     ggcggcacac tggccgcgag cgtcgcgctg cgtttgcgcg atgagggtgt cccgggcgtg       540
     cgcggtctcg cgctggtcta tccgatgctg ggcatcgaac cgcagctgcc ggcgcgcgac       600
     accgaggccg acgcgccgat gctcacgctt gccgatgtgc ggcgctacgg tgagctgtac       660
     tggcgcggac gccccgttga tacgtggacc gtgccgctcg aagcatcacg ctatgatgga       720
     ttgccgccga cgctcgccat cggcgtcgag cacgatccgt tgcgcgacga tgcccgtgtg       780
     ttcgccgaac gcattgtcgc ggcgcgcggg cgcgttgacg cgcccatcgg ccgtgggctg       840
     gtgcacggcg cctggcgggc tctggcgacg agtccaggcg tgcagtggat gcatcgcgaa       900
     gtgtgccgct ttctgagcgc acacgcggca gattga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page