(data stored in ACNUC29543 zone)

EMBL: CP001044.PE17

CP001044.PE17        Location/Qualifiers
FT   CDS_pept        complement(12787..13785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3118"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72286"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR60"
FT                   /protein_id="ACC72286.1"
FT                   /translation="MLNKLIDIARHIRRSERFKHSISTPGRITLHAQQRLNRGYFAIEI
FT                   RAHSGFFSVMQMVLFILMYCDEKRLTPLISARGGIYGDPQGQVDWFGEYFDTVGVPAAP
FT                   ASNMRLRTSVVHDLGGLGFRRRYESKLELRHASALFRAHYQPTAPIRAEVDAIRRRIGI
FT                   GAATLGVHFRGTDKKLEAHTIGWEDFCRLVERTLAEEPQLTHIFVSSDEQAFLDYFVKW
FT                   DFPVPVSVAPARLLATGSTPVHFSGHPGLAIGREALVASLLLANCGYLLKTPSYLSAWS
FT                   KLFNPSLPVMLAVPPREGAFWFPDSQIWNEQQARRRDAVEPDVRMPNQKTA"
     atgttgaaca agttgatcga catcgcgaga cacatccgac gcagcgagcg cttcaaacat        60
     tcgatcagca cgccgggccg catcacgttg catgcgcagc aacgtttgaa tcgcggctac       120
     ttcgcgattg agattcgcgc gcactcgggc ttcttctcgg tcatgcagat ggtgctgttc       180
     atcctgatgt attgcgatga aaagcgcctc acgccgctca tttcggcgcg cggcggcatt       240
     tatggcgatc cgcaaggcca ggtcgactgg ttcggcgaat acttcgatac cgtcggcgtg       300
     cctgccgcgc cggcgtcgaa catgcgattg cgcacgtcgg tcgtgcacga tctcggcgga       360
     ctcggatttc gccgccgtta cgaatcgaag ctcgagctgc ggcacgcgag cgcgttgttt       420
     cgcgcgcact atcagccgac cgcgccgatc cgcgcggaag tcgatgcgat ccgccggcgg       480
     atcggcatcg gtgccgcgac gctcggcgtg cattttcgcg gcaccgacaa gaagctcgag       540
     gcacatacca tcggttggga agatttttgc cggctcgtcg agcgcacgct cgccgaagag       600
     ccgcagttga cgcatatctt cgtgtcaagc gacgaacagg cgttcctcga ttacttcgtc       660
     aaatgggatt tcccggtgcc cgtcagcgtc gcgcccgcca ggttgctcgc gacgggcagc       720
     acgcccgtgc atttcagcgg gcatccgggg ctggcgatcg gccgcgaggc gctcgtcgcg       780
     agcctgctgc tcgcgaactg cggatatctg ctgaagacac cgtcttacct gtcggcgtgg       840
     tcgaagctat tcaatccgtc gttgcctgtc atgctggccg tgccgccgcg cgagggcgcg       900
     ttctggtttc cagacagcca gatctggaac gagcagcagg cgcgccgtcg cgacgcggta       960
     gaaccggacg tgcggatgcc caatcagaaa actgcctga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page