(data stored in ACNUC29543 zone)

EMBL: CP001044.PE172

CP001044.PE172       Location/Qualifiers
FT   CDS_pept        complement(211939..212868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3285"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   bch:Bcen2424_5051 protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3285"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72441"
FT                   /db_xref="GOA:B2JS64"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS64"
FT                   /protein_id="ACC72441.1"
FT                   /translation="MNHEVIVTCAVTGAGDTVAKHPAIPVTPKQIADAAIEAAKAGATV
FT                   AHCHVRDPRTGRGSRDPNLYREVVDRIRSADTDVIINLTAGMGGDLEIGPGEDPMRFGA
FT                   NTDLVGGLTRLAHVEELLPEICTLDCGTLNFGDGDYVYVSTPAQLRAGAKRIQELGVKP
FT                   ELEIFDTGHLWFAKQLLKEGLLDAPPLFQLCLGIPWGAPADTATMKAMVDNLPPGAHWA
FT                   GFGIGRMQMPMLAQAMLLGGHVRVGLEDNIWLDKGVPASNGSLVARAVEIIERLGGRAL
FT                   TPAEGRKKLGLPARGERPLEKRAVEQLA"
     atgaatcacg aagtaatcgt cacctgcgcc gtcacgggcg ctggagacac cgtcgccaag        60
     catcccgcta tccccgtcac gccgaaacag atcgccgatg ccgcgatcga agccgcaaaa       120
     gcgggcgcga ccgtcgcgca ttgtcatgtg cgcgatccca gaacgggccg cggcagccgc       180
     gatccgaacc tgtatcgcga agtcgtcgac cgcattcgtt ccgccgatac ggacgtcatc       240
     atcaatctga cggcgggcat gggcggagat ctggagattg gtccgggcga agatccgatg       300
     cgcttcggtg cgaacaccga tctggtcggc ggcctgacgc ggcttgcgca tgtggaagag       360
     ctattgcccg agatttgcac gctcgattgc ggcacgctga atttcggcga tggcgactac       420
     gtctatgtgt cgacgcccgc gcaattgcgt gcaggcgcaa agcgaattca ggaactgggc       480
     gtcaagccgg aactggagat attcgatacg gggcatctgt ggttcgcgaa gcaattgctg       540
     aaagaagggt tgctcgatgc gccgccgctg ttccagttgt gcctcggtat tccgtggggc       600
     gcgcccgccg ataccgcgac gatgaaggca atggtcgaca acctgccacc cggtgcgcat       660
     tgggccggct tcggcatcgg ccgcatgcag atgccgatgc tcgctcaggc gatgctgctg       720
     ggcggccacg tgcgcgtcgg actcgaagac aacatctggc tcgacaaggg tgtgcctgcg       780
     agcaacggat cgctcgtcgc gcgtgccgtc gagatcatcg agcgtctggg cggccgcgcg       840
     ctcacacctg cggaaggtcg caagaaactc ggtctgccgg cacgcggcga acggccgctc       900
     gaaaaacgcg ctgtcgaaca gctcgcctga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page