(data stored in ACNUC29543 zone)

EMBL: CP001044.PE178

CP001044.PE178       Location/Qualifiers
FT   CDS_pept        219364..220290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3291"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="TIGRFAM: choline sulfate-utilization transcription
FT                   factor; PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bte:BTH_II1856 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3291"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72447"
FT                   /db_xref="GOA:B2JS70"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS70"
FT                   /protein_id="ACC72447.1"
FT                   /translation="MSGPDRLPPMQTLSAFESAARLASFTAAARELGSTQPAVSQRIVQ
FT                   LEEDLGAPLFERGHRGVTLTPEGALLYEAVRSGLDTIRVATSDIRARRATGALTILTDA
FT                   GFATYWLMPRLARLKASMPGVNVKIVTSQLGYDPHRDHADIAIAFGDGHWPPCTSTRLF
FT                   AEAVTAVCSPAFRHLHPAVHTAADLAELPLLHVQPTEPERWLAWNSWFAAHGLAAPGES
FT                   QGMMFNSYSLVVQAALMGQGVALGWTPLTDELVATGQLVRLLDTPVTTERGYYLVCPPA
FT                   RPAPAAVPLFRRWLFNELVDVSEHAHA"
     atgtcgggac cagaccgtct tccgccgatg cagacgctat cggccttcga atcggccgcg        60
     cgcctcgcaa gcttcacggc tgccgcgcgc gagctcggct cgacacagcc agccgtgagc       120
     cagcgcatcg tgcagctcga agaagatctc ggggcgccgt tgttcgagcg cggccatcgc       180
     ggcgtgacac tcacgcccga aggcgcattg ctatacgaag ccgtgcgcag cggtctcgac       240
     acgatccgcg tggccacctc cgacatccgc gcgcgccgtg ccacaggcgc attgacgata       300
     cttaccgacg ccggcttcgc cacctattgg ctgatgccgc gtctcgcgcg cctcaaggca       360
     tcgatgccgg gtgtcaacgt aaagatcgtc acgtcccaac tcggctacga ccctcaccgc       420
     gatcatgccg acatcgccat cgcattcggc gacggtcatt ggcccccttg cacgtcaacg       480
     cgcctgttcg ccgaagccgt cacggccgtg tgttctcccg ccttccgcca tctccacccg       540
     gcggtgcaca cggccgccga tctcgccgaa ttaccgctgc tgcacgtgca gcccaccgag       600
     ccggagcgct ggctcgcgtg gaatagctgg ttcgccgcac acggtctggc ggcgccggga       660
     gaaagccagg gcatgatgtt caacagctat tcgcttgtcg tgcaggctgc gctgatgggc       720
     cagggtgtcg cgctcggctg gacgccgctg acggacgaac tcgtcgcgac tggccagttg       780
     gtgcgtctgc tggacacgcc cgtgacgacc gagcgcggct actacctcgt ctgcccgccc       840
     gcgcgacccg cgcccgccgc cgtgccgctg ttccggcgct ggcttttcaa cgagctggtc       900
     gacgttagcg agcacgcgca cgcctga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page