(data stored in ACNUC29543 zone)

EMBL: CP001044.PE181

CP001044.PE181       Location/Qualifiers
FT   CDS_pept        complement(223175..224038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3294"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: bch:Bcen2424_5076
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3294"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72450"
FT                   /db_xref="GOA:B2JS73"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS73"
FT                   /protein_id="ACC72450.1"
FT                   /translation="MKHLKKLMLCGALIATMTAIGTAAADTKPTIKIGYVEGWDDSVAT
FT                   SNVAAQIIEKRLGYPVQLVPVAAGIMWQGVARGDLDATLSAWLPVTHGAYWDQFKGKVQ
FT                   DLGANYTDAKIGLIVPADVPEKSISDLQAHKADFSGRIVGIDAGAGVMKKTSEAIKAYN
FT                   LDYQLMPSSGSAMTAELARSMNANKPVIVTGWVPHWMFAKWKLKFLEDPKKVYGESEHV
FT                   DSVVNPGLDAKAPQVVAFLKKFQWKPGEIDSVMLATENGAKPADAAGSWIAAHGDRVNS
FT                   WVGGAQ"
     atgaagcacc tgaaaaaact gatgttgtgc ggggcactga tcgcaacgat gaccgcgatc        60
     ggaaccgcgg ccgcagatac caaacctacc atcaagatcg gttacgtcga aggctgggac       120
     gacagcgtcg caacctcgaa cgtcgctgca cagatcattg aaaagcgact cggctatccg       180
     gtgcagctcg tgcccgtcgc ggcgggcatc atgtggcagg gcgtcgcgcg cggtgatctc       240
     gatgcaacgc tgtcagcgtg gctgcccgtc acgcacggtg cgtactggga tcagttcaag       300
     ggcaaggtgc aagacctggg agccaactac accgacgcaa agatcggtct gatcgtgccc       360
     gccgacgtgc cggagaaaag catcagcgat ctgcaggcgc ataaagctga cttctcgggc       420
     cgcatcgtcg gcatcgacgc cggcgcaggc gtcatgaaga aaaccagcga ggcgatcaag       480
     gcctataacc tcgactatca gctgatgccg agttcgggca gcgccatgac cgcggaactt       540
     gctcgctcga tgaatgccaa taaacctgtg atcgtcacgg gatgggtccc acactggatg       600
     ttcgcgaagt ggaagctgaa gttcctcgaa gatcccaaga aggtgtacgg cgagtccgag       660
     cacgtggata gcgtcgttaa tccgggcctc gatgcgaagg ctccgcaagt ggtcgcgttt       720
     ctgaagaaat ttcaatggaa gccgggcgaa atcgacagcg tcatgctggc gacagagaac       780
     ggcgccaagc ctgccgacgc agccggatcg tggatcgccg cacacggcga ccgcgtgaac       840
     agctgggtag gcggagcaca ataa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page