(data stored in ACNUC29543 zone)

EMBL: CP001044.PE183

CP001044.PE183       Location/Qualifiers
FT   CDS_pept        complement(225447..226727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3296"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   reu:Reut_B4815 Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3296"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72452"
FT                   /db_xref="GOA:B2JS75"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS75"
FT                   /protein_id="ACC72452.1"
FT                   /translation="MKVSADIQALVDRRKQGYSLEAPFYLSEEIFRLDMDAIFRQHWIQ
FT                   VAVEPDVPEPGDYVTVELGSDSILIVRDDDMQVRAFHNVCRHRGARLCNEDKGTVGNIV
FT                   CPYHSWTYNLSGDLMFAEHMGEQFDRCKHSLKSVHVENLAGLIFVCLAENPPVDFAVMR
FT                   AAMEPYLLPHDLPNCKIAAQIDIIEKGNWKLTMENNRECYHCVANHPELTISLYEYGFG
FT                   YQRSPANAEGMDAFERTCIERARQWEEMNLPSVEIDRLSDVTGFRTQRLPLDRSGESQT
FT                   LDAKVASKKLLGEFRQADLGGLSFWTQPNSWHHFMSDHIVTFSVIPLSAGETLVRTKWL
FT                   VHKDAQEGVDYDVSNLTAVWNATNDQDRALVEYSQRGASSSAYEPGPYSPFTEGLVEKF
FT                   SDWYVRRLASHIDSSASEPRTINIKAV"
     atgaaagtat cggcagacat tcaggcgctc gtcgatcggc gcaagcaggg atatagcctc        60
     gaagccccgt tctatctgag cgaagaaatc ttcaggctcg atatggacgc gattttccgt       120
     caacactgga ttcaggtcgc cgtcgagccg gacgtgcccg aacctggcga ttacgtgacc       180
     gtcgagctgg gcagcgattc gatcctgatc gtgcgcgacg acgacatgca ggttcgcgct       240
     ttccataacg tgtgccgcca tcgcggcgcg cgcctgtgca acgaggacaa gggcacggtc       300
     ggcaatatcg tgtgtccata tcacagctgg acatacaacc tgtcgggcga cctgatgttt       360
     gccgaacaca tgggcgagca gttcgaccgc tgcaagcaca gcctgaagag cgtgcatgtc       420
     gagaacctgg cgggtctgat cttcgtttgc ctcgcggaaa acccgcctgt cgatttcgcc       480
     gtgatgcgcg ccgcgatgga gccgtatctg ctgccgcacg atctgccgaa ctgcaagatc       540
     gccgcacaga tcgacatcat cgagaaaggc aactggaagc ttacgatgga gaacaatcgc       600
     gagtgctacc actgcgtcgc gaaccatccc gagctgacca tttctctcta cgaatacggc       660
     ttcggctatc agcgctcgcc ggcgaacgcg gaaggcatgg acgcgttcga gcgcacctgt       720
     atcgagcgcg ccaggcaatg ggaggagatg aatctgcctt ccgttgagat cgatcgtctg       780
     tcggacgtga cgggcttccg tacgcagcgt ctgccgctcg atcgcagcgg cgaatcgcag       840
     acgctcgacg cgaaggtggc gtcgaagaag ctgctcggcg aattcaggca ggctgatctt       900
     ggcggtctgt cgttctggac gcagcccaat tcgtggcatc acttcatgag cgatcacatc       960
     gtgaccttct cggtgattcc gctgtcggcg ggcgaaacgc tggttcgcac caaatggctt      1020
     gtgcacaagg acgcgcaaga gggcgtcgat tatgacgtga gcaacctgac ggccgtgtgg      1080
     aacgccacca acgaccagga ccgtgccctc gtcgaatact cgcagcgcgg cgcgtccagc      1140
     agcgcgtatg agccggggcc gtactcgccg ttcacggaag ggctggtcga gaagttcagc      1200
     gactggtatg tgcggcgcct cgcttcgcac atcgacagct cggcttctga gccgcgcaca      1260
     attaacatca aggccgtttg a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page