(data stored in ACNUC29543 zone)

EMBL: CP001044.PE186

CP001044.PE186       Location/Qualifiers
FT   CDS_pept        complement(228727..230646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3299"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224 cysteine-rich
FT                   region domain protein; KEGG: bte:BTH_II1864 iron-sulfur
FT                   cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3299"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72455"
FT                   /db_xref="GOA:B2JS78"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021872"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS78"
FT                   /protein_id="ACC72455.1"
FT                   /translation="MSPAFLITALLWVSVAGLAFAVAKRAAYWRLGRATAAGAFGWTNL
FT                   LTIPKRYFVDLHHVVARDPYIAKTHVATAGGAIAAFALVFINYGLAIYSPWLDRLIFLA
FT                   ALIMLVGAVFVWRRRHAKDVPARLSRGPWNTLPWLLGSFALGLLLYTLLPASAMSGGLA
FT                   ILFAVLIGVGAFTMTFGAARGGPMKHALAGLLHLAFHPRQERFAAQGDVRKEQAIPPTA
FT                   LKAPVLEQNEYGVGKPVEFRWNQLLSFDACVQCGKCEAACPAFAAGQPLNPKKLIQDLV
FT                   TGMVGGNDAAYAGSPTPGIKVGQHGGEPQRPIISSLIEADTVWSCTTCRACVHECPMLI
FT                   EHVDAIVDMRRNQTLVHGTVPGKGPEVLANLRETGTMGGYDKAARYDWSVDLSSPVAQP
FT                   GQAVDVLLVAGEGAFDMRYQRTLRSLVKVLNKAGVKYAVLGSQETDTGDVARRLGDEAT
FT                   FQRMAKQMMGTLSALNFKRIVTADPHVMHSLRNEYRALGGRYEVLHHTTFLAELVASGK
FT                   LSPKAVAAFNDKKITYHDPCYLGRYNGETEAPRQLLKTIGIKVVEMERHGKRGRCCGGG
FT                   GGAPLTDIPGKQRIPDIRINDARSIGADVVAVGCPNCTAMLEGVVGPRPEVLDVAELVA
FT                   AALE"
     atgagcccgg cgtttctcat caccgcgttg ttgtgggtat ccgtcgccgg ccttgcgttc        60
     gcggtcgcaa aacgggcggc ttactggcgt ctcggacggg caacggcagc cggcgcattc       120
     ggctggacca atctgctgac catcccgaag cgctatttcg tcgatctgca tcatgtcgtg       180
     gcgcgcgatc cgtacatcgc gaagacgcac gttgccaccg caggcggcgc gattgccgcc       240
     ttcgcgctgg tcttcatcaa ctacggtctg gcgatctatt cgccatggct cgaccggctg       300
     atctttctgg ccgcgttgat catgctggtg ggcgccgtgt tcgtgtggcg ccgccgtcat       360
     gcgaaggatg tgcccgcacg tctgtcgcgc ggtccgtgga atacgctgcc ctggctgctc       420
     ggctcgttcg cgctcggtct gctgctgtac acgctgttgc ccgcatcggc gatgtcgggt       480
     ggcctcgcga tcctcttcgc ggtgctgatc ggcgtcggcg ctttcacgat gacgttcggc       540
     gcggcgcgcg gcggtccgat gaagcacgcg ctggccggtc tgctgcatct ggcgttccat       600
     ccgcgtcagg agcgtttcgc ggcacaaggc gacgtgcgca aggagcaggc cattccgccg       660
     acggcgctca aggcgcccgt gctcgagcag aatgaatatg gcgtcggcaa gcccgtcgag       720
     tttcgctgga atcaactact gagcttcgat gcatgcgtgc aatgcggcaa gtgcgaggca       780
     gcgtgccccg cgtttgcggc aggccagccg ctgaatccga agaagctgat tcaggacctc       840
     gtgacgggca tggtcggcgg caacgacgca gcgtatgcgg gcagtccgac gcccggcatc       900
     aaggtcggcc agcatggcgg cgagccgcag cgaccgatca tctccagcct gatcgaagcc       960
     gataccgtgt ggtcgtgcac gacgtgccgc gcctgcgtgc atgaatgccc gatgctgatc      1020
     gaacatgtgg acgccatcgt cgacatgcgc cgcaaccaga cgctcgtgca cggcacggtg      1080
     ccgggcaagg gtcctgaagt gctcgcgaat ctgcgcgaga caggcactat gggcggctac      1140
     gataaggccg cgcgttacga ctggtcggtc gatctcagct cgcctgtcgc gcaaccgggt      1200
     caggctgtcg acgtattgct cgtcgctggt gaaggtgcgt tcgatatgcg ctatcaacgc      1260
     acgctgcgct cgctcgtcaa ggtgttgaac aaggcaggcg tcaaatacgc ggtgctcggc      1320
     tcgcaggaaa cggatacggg cgatgtcgcg cgccgtctcg gtgacgaagc cactttccag      1380
     cgtatggcga agcagatgat gggcacgttg tccgcgctga atttcaagcg catcgtcacc      1440
     gccgatccgc acgtgatgca cagcctgcgc aacgaatacc gcgcgctcgg cggccgctac      1500
     gaagtgctgc atcacacgac gttcctcgcg gaactggtcg cgagcggcaa gctgtcgccg      1560
     aaagcggtgg ccgcgttcaa cgacaagaag atcacgtatc acgatccttg ctacctcggc      1620
     cgctacaacg gcgaaacgga agcgccgcgc cagttgctga agacgatcgg catcaaggtc      1680
     gtcgagatgg agcggcacgg caagcgcgga cggtgctgtg gcggtggcgg cggtgcgccg      1740
     ctaacggata tccctggcaa gcagcgcatt cccgatatcc gcatcaacga cgcacgctcg      1800
     atcggcgcgg acgtggtcgc ggtgggttgc ccgaactgca cggcgatgct cgaaggcgtg      1860
     gtcggtccac ggcccgaggt gctcgatgtg gccgaactcg ttgccgcagc gctggagtga      1920
//

If you have problems or comments...

PBIL Back to PBIL home page