(data stored in ACNUC29543 zone)

EMBL: CP001044.PE194

CP001044.PE194       Location/Qualifiers
FT   CDS_pept        complement(241177..242376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3307"
FT                   /product="formaldehyde dehydrogenase,
FT                   glutathione-independent"
FT                   /note="TIGRFAM: formaldehyde dehydrogenase,
FT                   glutathione-independent; PFAM: Alcohol dehydrogenase
FT                   zinc-binding domain protein; Alcohol dehydrogenase GroES
FT                   domain protein; KEGG: bxe:Bxe_B1589 glutathione-independent
FT                   formaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3307"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72463"
FT                   /db_xref="GOA:B2JS86"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014184"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS86"
FT                   /protein_id="ACC72463.1"
FT                   /translation="MSSNRGVVYLGQGKVEVRPIDYPKMVDPRGRAIGHGVILKVVSTN
FT                   ICGSDQHMVRGRTTAEIGLVLGHEITGEVIEVGRDVETLKIGDLVSVPFNVACGRCQTC
FT                   KEQHTGVCLNVNPSRAGGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDRAMEKIR
FT                   DLTCLSDILPTGYHGAVMAGVKPGSTVYIAGAGPVGMAAAASARILGAACTIIGDMNEE
FT                   RLAHARAVGFETVNLSKDATLGEQIAQILGKPEVDCAVDCVGFEAHGHGSSGAREEAPA
FT                   TVLNSLMDITKPAGAIGIPGLYVTDDPGAVDSAAKKGSLSIRFGLGWAKSHSFHTGQTP
FT                   VMKYNRNLMQAILWDRLPIADIVNVTVISLDSAPDGYRQFDGGAPRKFVLDPHGLLKAA
FT                   "
     atgagcagca atcgcggtgt cgtgtatctg gggcagggca aggttgaagt acggccgatt        60
     gattatccga agatggtcga tccgcgcgga cgcgcgatcg gccacggcgt gattcttaaa       120
     gtggtatcga cgaatatttg cggctcagac cagcacatgg tgcgcggccg cacgacggcg       180
     gaaatcggcc ttgttttagg gcacgaaatc acgggtgaag tgatcgaggt gggccgcgac       240
     gtggagacgc tgaaaatcgg cgacctggtg tccgtgccgt tcaacgtcgc gtgcggccgc       300
     tgccagacct gcaaggaaca gcatacgggc gtgtgcctga acgtgaaccc gtcgcgtgcg       360
     gggggcgcgt acggttacgt cgacatgggc ggctggatcg gcgggcaggc cgaatacgtg       420
     ctggttccgt acgcggattt caatctgctg aagtttcccg atcgcgaccg cgcgatggaa       480
     aagattcgcg acctcacgtg tctctccgac attctgccga cgggctatca cggcgcggtg       540
     atggcgggcg tgaagccggg ttcgacggtg tatatcgcgg gcgcggggcc cgtcggcatg       600
     gcggcggccg catcggcgcg catcctgggt gcggcctgca cgatcatcgg cgacatgaac       660
     gaagagcggc ttgcgcatgc gcgtgccgtc ggcttcgaga cggtcaatct gtcgaaggac       720
     gcgacgctcg gcgagcagat cgcgcagatt ctcggcaagc ccgaggtgga ttgcgccgtc       780
     gattgcgtcg gcttcgaagc gcatggccac ggcagcagcg gtgcgcgcga ggaagcgccc       840
     gccacggtgc tcaattcgct gatggacatc acgaagcccg ctggcgcgat cggcattccg       900
     ggtctgtatg tgaccgacga tccgggcgca gtcgattccg ccgcgaagaa aggcagcctg       960
     tcgatccgct tcggcctcgg ctgggcgaag tcgcactcgt tccacacggg gcagacgccc      1020
     gtgatgaagt acaaccgcaa tctgatgcag gcgattctgt gggaccgctt gcccatcgcg      1080
     gatatcgtca acgtgacggt gatttcgctg gacagcgcgc ccgatggcta ccgtcagttc      1140
     gatggcggcg cgccgcgcaa gttcgtgctg gatccgcatg gtttgctgaa ggctgcgtaa      1200
//

If you have problems or comments...

PBIL Back to PBIL home page