(data stored in ACNUC29543 zone)

EMBL: CP001044.PE2

CP001044.PE2         Location/Qualifiers
FT   CDS_pept        complement(737..1435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr6665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3103"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72271"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR026928"
FT                   /db_xref="InterPro:IPR033468"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR45"
FT                   /protein_id="ACC72271.1"
FT                   /translation="MLTLYSYPDLYGVADNNAFGLKVYAFMRLCGLEFEHRHILDTSHA
FT                   PRGQLPYLSDDGETVGDSDAIIAYLKGRYDLRVDAALSQGQANLDFLVRRTLDDLYWPM
FT                   SYSRWRDERYWPAFRDAVLREHADVTANDLEAAREYNRQRYHYQGIGRYEPDQVYVRGI
FT                   GDLRVVADLLGNSGFVFGPEPATIDAAIYGFVANIYFYEIDTPLKAYVVSRPELVRHCR
FT                   AVHERIAAKA"
     atgctgacgc tctactcgta ccccgatctg tatggtgtcg ccgataacaa cgcgttcggc        60
     ctgaaggtct acgcgttcat gcggctatgc gggctcgaat tcgagcaccg gcatattctc       120
     gatacctcgc acgcgccgcg cggccagctg ccctatctgt cggatgatgg cgagacggtc       180
     ggcgacagcg acgcgatcat cgcgtatctg aagggcagat acgatctgcg ggtcgatgcc       240
     gcgctgtccc aggggcaggc gaatctcgac tttctggtgc gccgcacact cgacgacctc       300
     tactggccga tgagctattc gcgctggcgc gacgaacgct actggccggc gtttcgcgat       360
     gccgtgctgc gcgagcatgc ggacgtcacg gcgaacgatc tcgaagcggc acgcgagtac       420
     aaccggcagc gctatcacta tcagggtatc ggccgctacg agcccgatca ggtgtacgtg       480
     cgcgggatcg gcgatctgcg cgtcgtcgcc gatctgctcg gcaacagtgg cttcgtgttc       540
     ggccccgaac cggcgaccat cgacgcggcg atctacggct ttgtcgcgaa catttacttc       600
     tacgaaatcg acacgccgtt gaaagcgtat gtggtgtcgc ggcccgaact ggttcgtcat       660
     tgccgcgcgg tgcacgagcg cattgcagcg aaggcttga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page