(data stored in ACNUC29543 zone)

EMBL: CP001044.PE20

CP001044.PE20        Location/Qualifiers
FT   CDS_pept        complement(15886..17373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3121"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bur:Bcep18194_B1880 transcriptional
FT                   regulator, GntR family with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3121"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72289"
FT                   /db_xref="GOA:B2JR63"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR63"
FT                   /protein_id="ACC72289.1"
FT                   /translation="MNLLNDESLLSHDRAHAQADAPLYERLAAHYRRVIASGTLAPGDR
FT                   MPSVRALMSRHKVSLSTAIQVFRRLEDGGWLQARPRAGYFVRRPAASKLATVAEPDIPV
FT                   LPEPARYVGLHERISRVIERAQAFPDALNLGGATAGAALYPTERLQSLASRILRHKPTL
FT                   LTEVGEDGGAAELRQAIAKRALTADVTVAPDDVLITSGGVEAVNLALRAVAQPGDTIAV
FT                   ESPAFFGLLQILESLGLRALEIPTSPTTGLSLEALDIALTACPEIKAVVAVPNLQNPLG
FT                   CVMPDTRKAELVALCARRGVALIEDEPYRELVEAAQPARPLKSWDRDGGVIHCASLNKA
FT                   LAPGMRLGWMSSGRWHARVRLLKFAQTRHNESLAQFVAAEFIGSGAYDRHLHRLRDKLR
FT                   VQREASADAIGRYFPAGTRLNLPPGGLLLWVALPDGRSSDALFEAALPHGIRIAPGSIF
FT                   SNSERFRSFIRLSCPVPFDERMDAALRQLGRLAAGIA"
     atgaatctgt tgaacgacga atctctcctt tcgcacgacc gggcgcatgc gcaagccgac        60
     gcaccgctat atgaacgcct cgccgcgcac tatcgccggg tgattgcgtc ggggacgctc       120
     gcgcccggcg accggatgcc gtcggtgcgc gcgctgatga gtcgacacaa ggtgagtttg       180
     tcgacggcga tccaggtgtt ccggcgtctc gaagacggcg gctggctgca ggcgcggccg       240
     cgcgccggct actttgtccg gcgtccggcc gcctcgaaac tcgcgactgt cgccgagccg       300
     gacattccgg tactgcccga gccggcgcgt tatgtcggct tgcacgagcg catctcgcgg       360
     gtgatcgagc gcgcgcaggc gtttcccgac gcgctgaacc tgggcggcgc gacggcgggc       420
     gccgcgctgt atccgacgga gcggttgcag tcgctcgcgt cgcgcatcct gcgtcacaag       480
     ccgaccttgc tgacggaagt cggcgaagac ggcggcgcag cggaactgag gcaggccatc       540
     gcgaagcgcg cgttgacggc ggacgtgacc gtcgcgcccg acgacgtcct catcacaagc       600
     ggcggcgtcg aagcggtgaa cctcgcgctg cgcgccgtcg cgcagccggg cgacacgatt       660
     gccgtcgaat cgccggcgtt tttcgggctg ttgcagatac tcgaaagtct cgggctgcgc       720
     gcactcgaaa taccgaccag cccgacgacg ggtctgtcgc tcgaagcgct cgacatcgcg       780
     ctgaccgcct gcccggagat caaggccgtc gtcgcggtgc cgaacctgca gaatccgctc       840
     ggttgcgtga tgcccgacac acgcaaggcc gaacttgtcg cgttgtgcgc gcgccgtggg       900
     gtcgcgctga tcgaggacga gccgtatcgc gagctggtcg aagcggccca gcccgcgcga       960
     ccgctgaagt cctgggaccg cgacggcggt gtgattcatt gcgcgtcgct caacaaggcg      1020
     ctcgcgccgg gcatgcggct ggggtggatg tcgtcgggac gctggcacgc tcgcgtgcgg      1080
     ctcctgaagt tcgcgcagac gcggcacaac gaatcgctgg cgcagttcgt ggcggccgag      1140
     ttcatcggct cgggcgcgta cgatcgccat ctgcaccgct tgcgcgacaa gctgcgcgtg      1200
     cagcgcgagg cgagtgcgga tgccatcggc cgctatttcc ctgcgggcac gcggctgaac      1260
     ctgccgccgg gcggtttgct gttatgggtc gcgctgccgg acgggagatc gtcggatgcg      1320
     ctgttcgaag cggcgttgcc gcacggcatt cgcattgcgc ccggttcgat cttctcgaac      1380
     tcggagcggt tccgctcgtt catccgtctc agttgccccg taccgttcga cgaacggatg      1440
     gacgctgcgc ttcgtcaact cggccgtctg gccgccggca tcgcctga                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page