(data stored in ACNUC29543 zone)

EMBL: CP001044.PE200

CP001044.PE200       Location/Qualifiers
FT   CDS_pept        complement(249700..251040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3313"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; KEGG: bpd:BURPS668_0636 sigma-54 dependent
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3313"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72469"
FT                   /db_xref="GOA:B2JS92"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS92"
FT                   /protein_id="ACC72469.1"
FT                   /translation="MNLNLKRLYHVCNPERASLHGNLPSLQWRIRSIDIRARQGAALLA
FT                   SHRAAGLIEFSSLNIPADLHEVDELTRSSGEISWVAVVTNAHLNDPEIGRIVRTRCVSY
FT                   IRLPAAAETIAQELDRAYEMSAVDVIEHKNASGGALAMIGACAAMGDVRAAIRTASEHE
FT                   RPVTIIGESGSGKALTASSIHQGSSRREGPFVSIDCAAYPPERVEAELFGVGETKAETG
FT                   NQHSRLNMAEGGSLYIDGVCELPLAAQERLADLVGSGARNVRIICSTHIGLQRAADEHR
FT                   LHARLFASLSAATITIPPLRERGPDIRLLAAHLLKSFRSDSRHNVRGFSVCAWEAFDTH
FT                   TWPGNVREMINRIRHAIVASSGHLITARDLGFEHVASMPIIRRASADESDAIPEWDAIE
FT                   LAVARNQGRLDAAATELHISKVLLARMLASNARRAAGAPGALRMDSA"
     atgaatttaa atctgaaacg gctctatcac gtgtgcaacc ccgagcgcgc atctctgcac        60
     ggcaatcttc cgtcgctgca atggcgcatc cgcagtatcg acatccgcgc acgccagggc       120
     gccgcgttgc tcgccagtca tcgcgccgcc ggtttgatcg aattttcttc gttgaacatt       180
     cccgccgatc tgcacgaagt cgatgaactc acgcgttcga gtggcgagat cagctgggtc       240
     gccgtggtca cgaacgcgca tctcaacgat ccggaaatcg ggcgcatcgt gcggacgcgt       300
     tgcgtaagct atatccgcct gcccgcagcg gcggaaacga tcgcgcagga gctggatcgc       360
     gcctatgaga tgtcggccgt cgatgtgatc gaacacaaga acgcgagcgg cggggcgctt       420
     gcgatgatcg gtgcatgcgc tgcgatgggc gacgtgcggg cggcgatacg gactgcatcg       480
     gaacacgagc gtccagtaac gattatcggc gagtcgggca gcggaaaggc gctcacggcc       540
     tcgtcgatcc atcagggctc gtcgcgccgc gaagggccgt tcgtctcgat tgattgtgca       600
     gcttatccac ccgagcgcgt ggaagcggag ctatttggcg taggggagac gaaagccgaa       660
     acgggcaatc agcattctcg cctgaacatg gcggagggcg gctcactgta catcgacggt       720
     gtttgcgaac tgccgcttgc agcacaggaa cggctcgcag atctggtcgg tagcggagca       780
     cgcaatgtgc gcatcatctg ctcgacacat atcggcttgc agcgcgctgc agacgagcat       840
     cgtctgcacg cgcgtctttt tgcgtcgctc tccgccgcga cgattacgat tccgccgctg       900
     cgcgagcgcg ggcccgacat tcgtctgctc gccgcgcatc tattgaagag cttccgctca       960
     gattcccgtc acaacgtgcg gggtttttcc gtgtgtgcgt gggaagcgtt cgacacgcac      1020
     acgtggcccg gcaacgtgcg cgaaatgatc aaccgcatcc ggcacgcaat tgtggccagc      1080
     agcggccacc tgatcacggc gcgcgacctg gggttcgagc atgtcgccag catgccgatc      1140
     atacggcggg catccgccga cgaatccgat gctatccccg aatgggacgc gatcgaactg      1200
     gccgtcgcgc gaaatcaggg ccggctcgat gcggcggcga cggaactgca catttcgaag      1260
     gtattgctag cgcgcatgct cgcgtcgaat gccaggcggg cggcgggagc gcccggcgcg      1320
     ctgcggatgg actccgcgta a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page