(data stored in ACNUC29543 zone)

EMBL: CP001044.PE201

CP001044.PE201       Location/Qualifiers
FT   CDS_pept        complement(251800..252279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3314"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bte:BTH_II1006
FT                   OsmC/Ohr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3314"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72470"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS93"
FT                   /protein_id="ACC72470.1"
FT                   /translation="MARHTALIEWSSNGSKFTDNRYSRAHQWTFDGGAVVPASSSPHVV
FT                   RVPFSDPAGVDPEEAYIAALSSCHMLWFLSIAVEQGYVVTSYRDAAEGTMAKNDEGKEV
FT                   IARVVLKPAVAFAGAKAPSDEALAHLHHLAHDACFLANSVKTVIDVEGSWSFREP"
     atggccaggc atacggcgct catcgaatgg agcagcaacg gcagcaagtt cacggacaat        60
     cgctatagcc gcgcgcatca atggacgttc gacggcggcg cggtggtgcc cgcatcgagt       120
     tcgccacacg tcgtgcgtgt gccgttctcc gatcccgccg gcgtcgatcc ggaagaggcc       180
     tatattgcag cgctgtcgag ttgccacatg ctgtggtttc tttcgatcgc ggtggagcag       240
     ggctatgtcg tcacgtcgta ccgcgatgca gccgaaggca cgatggccaa aaatgacgag       300
     ggcaaggaag tgatcgcgcg tgtcgtgcta aagcccgctg ttgcattcgc gggcgcgaaa       360
     gcgcccagcg acgaagcgct agcgcatctg caccatctcg cccacgacgc ctgctttctc       420
     gccaattcgg tcaagacggt gatcgatgtc gagggaagct ggagtttccg cgagccttga       480
//

If you have problems or comments...

PBIL Back to PBIL home page