(data stored in ACNUC29543 zone)

EMBL: CP001044.PE202

CP001044.PE202       Location/Qualifiers
FT   CDS_pept        complement(252311..253243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3315"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: bxe:Bxe_B1744 putative
FT                   2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3315"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72471"
FT                   /db_xref="GOA:B2JS94"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS94"
FT                   /protein_id="ACC72471.1"
FT                   /translation="MKPSLLVLIPLGDDSRARIAASFDLHYAPTHEARTAAVGTHGAAI
FT                   RAVLTNGTTGLTSAEIDAMPALEFVSALGAGYENIAVDHARARGIVLANGAGTNDDCVA
FT                   DHAMALLLAVVRDVPQRDRATREGIWRDALPMRPSVSGKRLGVIGLGNIGRKVARRAEG
FT                   FDIEIGYHNRNARDGVAWRYFDDVREIARWSDYLVVATPGGPSTHHLIDRDVLEALGRQ
FT                   GFLVNVSRGSVVDTDALAHALGNGVIAGAGLDVYEGEPRPPQALLHLPNVVLTPHVAGT
FT                   SPEAIGASVDNFITNATRHFAGEDVLTPI"
     atgaaacctt ccctgctcgt cctgattccc cttggcgacg acagtcgcgc acgcatagcc        60
     gcatcgttcg atcttcacta cgctccgaca cacgaagcac gcacggcagc cgtcgggaca       120
     cacggtgcag cgattcgcgc ggtgttgacc aatggcacga cgggtttgac gtcggctgaa       180
     atcgacgcga tgcctgcgct cgaattcgtc agcgcgctcg gcgcgggcta cgaaaacatt       240
     gcggtggacc atgcgcgtgc gcgcggcatc gtgctcgcga acggtgcagg cacgaacgac       300
     gattgcgttg ccgatcatgc gatggccttg ctgcttgccg tcgtacgcga cgtgccgcag       360
     cgcgaccgcg cgacacgcga aggcatctgg cgcgacgcgt tgccgatgcg cccgtccgtg       420
     tcgggcaaac ggctcggtgt aatcggtctc ggcaatatcg gccggaaggt tgcgcggcgc       480
     gcagagggct tcgatatcga aatcgggtat cacaaccgca acgcgcgcga cggtgtcgcg       540
     tggcgctatt tcgacgacgt gcgcgagatc gcgcgctgga gcgactatct cgtcgtggcg       600
     acgccgggcg gaccgtcgac gcatcatctg atcgatcggg acgtgctgga agcactggga       660
     aggcagggct ttctcgtgaa cgtgtcgcgc ggcagcgtcg tcgatacgga tgccctcgca       720
     cacgcgctgg gcaacggcgt gatcgccggc gcgggcctcg atgtgtacga gggcgaaccg       780
     cggccgccgc aggcgctgct gcatctgccc aacgtcgtgc tcacgccaca tgtggcgggc       840
     acgtcgccgg aagccatcgg cgcttccgtc gacaacttca tcaccaacgc tacgcgtcac       900
     ttcgcgggcg aagatgtgct gacacccatc tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page