(data stored in ACNUC29543 zone)

EMBL: CP001044.PE205

CP001044.PE205       Location/Qualifiers
FT   CDS_pept        255079..255990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3318"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rru:Rru_A2875 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3318"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72474"
FT                   /db_xref="GOA:B2JS97"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS97"
FT                   /protein_id="ACC72474.1"
FT                   /translation="MVEPDLADLKAFVSVAAARGFRNAASRGGVSASSLSEAIRRLEQQ
FT                   LGVRLLNRTTRSVTPTEAGQRLFERLAPAFGEISTALDAINLFRDSPTGTLRLNVPSIA
FT                   AREILPALLSRFLAGHPGITVEVTSNDTFIDILAAGFDAGIRYDERLERDMIAVPIGPP
FT                   MQRMIAAASPAYLQQHGEPRHPDELVWHACIGHRFESGVLAVWEFTRGDDTVRIVPNGP
FT                   IVASVIDIQLRAAVDGLGIVYSFDEFLRPALDDGTLVPILRDWWQSFTGPRLYYASREH
FT                   MPAPLRAFVDFVLRDNRSRDAG"
     atggtcgaac ccgatctggc cgatctgaaa gccttcgttt cggtcgcggc cgctcgcggc        60
     tttcgcaacg ccgcgtccag gggcggcgtg tctgcgtcgt cgctgagcga agccatcagg       120
     cgtctcgagc agcaactggg cgtgcgtctg ctgaaccgga ccacgcgcag cgtcacgccg       180
     acggaagccg gccagcgcct gttcgaaagg ctcgcgcccg cgttcggaga aatctcgacc       240
     gcgctggatg cgatcaacct gttccgcgac agtcccacgg gcaccttgcg tctgaacgtg       300
     ccgtcgatcg ccgcgcgtga aatcctgccc gcgctactgt cgcggttcct ggccggacat       360
     cccggcatca ccgtcgaggt gacgtcgaac gacacgttca tcgacatcct tgcggcgggt       420
     ttcgacgcgg gcatccgcta cgacgaacgc ctggagcggg acatgattgc cgtcccgatc       480
     ggcccgccga tgcagcgcat gatcgcggcc gcgtctcctg cgtatctgca gcagcacggc       540
     gagccccgcc atcccgacga actggtgtgg cacgcatgca tcggccaccg cttcgaaagc       600
     ggcgtgctgg ccgtatggga attcacgcgc ggcgacgaca ccgtacgcat cgtgccgaac       660
     gggcccatcg tggcttccgt aatcgacatc cagctgcgcg ccgccgtgga cggactcggc       720
     atcgtctatt cgttcgacga gtttctgcgt cccgcgctcg atgacggcac gctcgtgccg       780
     attctgcgcg actggtggca atcgttcacc gggccgcgtc tgtactatgc gagccgcgag       840
     cacatgcccg cgccgctgcg cgccttcgtc gacttcgtgc tgcgcgacaa tcgcagccgg       900
     gacgcggggt ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page